SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449668763|ref|XP_002161897.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449668763|ref|XP_002161897.2|
Domain Number 1 Region: 21-160
Classification Level Classification E-value
Superfamily C-type lectin-like 5.77e-33
Family C-type lectin domain 0.00068
Further Details:      
 
Domain Number 2 Region: 197-305
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-30
Family Spermadhesin, CUB domain 0.00084
Further Details:      
 
Domain Number 3 Region: 320-420
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-20
Family Spermadhesin, CUB domain 0.003
Further Details:      
 
Domain Number 4 Region: 546-610
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.1e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 5 Region: 1692-1823
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.37e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 6 Region: 890-959
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.36e-16
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 7 Region: 2018-2215
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-16
Family Laminin G-like module 0.034
Further Details:      
 
Domain Number 8 Region: 424-493
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000431
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 9 Region: 598-664
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000514
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 10 Region: 477-537
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000625
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 11 Region: 766-832
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 12 Region: 823-901
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000695
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 13 Region: 1592-1634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000219
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 14 Region: 1819-1860
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000401
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 15 Region: 1553-1595
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000566
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 16 Region: 1629-1671
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000067
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 17 Region: 1935-1978
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000921
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 18 Region: 1973-2013
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000219
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 19 Region: 631-740
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000282
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 20 Region: 1515-1558
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 21 Region: 1478-1519
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000392
Family EGF-type module 0.013
Further Details:      
 
Domain Number 22 Region: 1345-1486
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000785
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 23 Region: 154-195
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000012
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 24 Region: 1896-1939
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000014
Family EGF-type module 0.022
Further Details:      
 
Domain Number 25 Region: 944-1009
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000153
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 26 Region: 1853-1895
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000726
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 27 Region: 2322-2377
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000106
Family Complement control module/SCR domain 0.0061
Further Details:      
 
Weak hits

Sequence:  gi|449668763|ref|XP_002161897.2|
Domain Number - Region: 1286-1376
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0816
Family Growth factor receptor domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449668763|ref|XP_002161897.2|
Sequence length 2390
Comment PREDICTED: uncharacterized protein LOC100208285, partial [Hydra magnipapillata]
Sequence
MVACNTNVKGYVDSKQNNEFYAANYKCPNGWQQRCEKCYLYVNESKQWTDAQYYCKQNGG
NLVTIKEDAVNLFLARYVQYSSRLAITIWTGLHARKVHKEFQWVDNSESVHYEFRWLPGQ
PNMVTLDEGCVEMYTKSRQYLWDDVSCSKESPFVCQTDGCIIGTQRCDNGKCVSKHLFCD
SKNDCGDFSDEKNCTKCNEHYTAQEGSISSPNFPQHYGNNRDCTWLIEVESSYIIEIKFL
EFFIENSFDWVEVFDGPTLASKSFGKFSGNFKPEVILSSSSKILVHLKSDKSTSDKGFFA
RYKAVKKGCNVDLIINSNKPEYISSPNFPLNYPDNTKCEWTIRNEDPSKILTFQLLELET
EENDFIEVRDGLTEDNALLGKFFGNFSNIQKRHIFTSNFKMHVKFQSNFQLNQKGFRAVI
FSGCPMLPAINGGSFRQDQKFYGASVEYKCDSRFRIKSENGNVRKCMYGGNWSEPAPFCE
EINCGHPGTIENGGFEIYPLNSTFVFMTSVKYSCNVGYILVGEPNRVCQVNSTWSGGVER
KCEVLKCPDPGTPVNGTRSGNEFNVGSSITFSCEKGFRRHGARTITCGITGKWSSETPLC
KVVVCQLPSFSLNTIISSSSIGFNTPYKTVLHISCKKGFELIGSVNITCTESGAWKPDVP
QCIDINECLNNPCRGLGSQCTNLMGSYKCTCKSGFRQIDETTCEDIDECKSSGKTVKCNQ
KCTNIDGGYFCSCEDGYFLYDGDNKTVNRVEAEESFVNHTCLGNPCKLPKIPENGYILNY
GNRYPTEITFQCDKGWIVDGDLSIKCLKNGSWSGSISDCIAARCNPLPDVPNSSSVVDGG
LVKGQYSQGTIYTYTCINGYEIISGNSKRMCSQNATASFWSGSSPVCERVSCGPLENPKN
GHVNITGDKYGDSSKFFCDGGYIITGNDSSTCQANGRWSASSPFCLASPCPDPGIPINGE
IIGLISLDQTITFRCLVNGSILIGDNKRTCIFNKSTGLNQWNGSQPFCKDTSTPTFKFCP
MSTIEFTLPQSEKSMMVNWTLPTLTDNVHNLLNITVSPDYVSPMVMPAGLNIITYTATYK
DGSTAVCEVKINVQDKEIPKIFCPKNIVIKSDLSSKVFWSDGIYTDNVGIKNVIFNPPNG
TILESNKYHKVTMTVEDISGNSDSCVMEIYVEERKPLISCLKGSLSIDFTTTGDNTNEKP
FLDIFTFLNNLKNSTCSFIYQTGNLISNGTSVAGDFKILSHDDGVIPLLNGHLEECKTIL
LKDLDLFKTNLLQLTSSVDIKLLNISSCCPLNKSYCCPTGHLIKTTGLTVKASYCIPCGL
GMYHNSTNNKCLNCPVGFYNDLEFADQCKRCPNETNNLKVQSDSCTKMCAAGSYSSTGLE
PTCRKCDYGEYQSQVGAYNCIKCPYNLTTSRSGSENISECKAQCSPGTYSSTGLEPCTKC
AKGLFQNEIGRSYCKLCPSGGIYLGMEGATSEANCPSKNACDEKPCRNGATCNAGNYSYT
CTCKPGWTGVNCEVDIDECASSPCGRHGTCTNLINDFNCTCIKGIIGKQCETNIDDCKND
TCRNGGICNDLVDDFKCLCAAGFEGKRCEINKNECEPNPCLKNSTCEDLINDFKCNCIPG
YVGKLCDVDIDECAMSPCFNNATCVDKVNAFECKCQPGFNGTLCETDIDECSTQPCANNG
SCIDIVNGFLCKCIDGFRGSNCSINIDECDPSPCLHNSTCVDQINGFQCECSPGYFGLRC
ETEINECESQPCSNNATCVDKINDYQCLCNIGFEGKQCEIDINECQPNPCVNGSCKDLVG
DYLCECQPGFDGRNCSNLIDNCFSLPCKNNGNCTNKVNNYTCTCQAGFSGSDCETNINEC
DPDPCNSNALNCTDLINGYICYCKLGFRGENCSEIIDNCNPQPCRHNSTCTNRFVTNDFH
CNCSLGYEGDRCEIEIDECKALPCKNGGNCTDLPGKYLCTCPPGFTGVDCEINIDDCKNV
SCLNGGKCIDLINSYVCECPVTHKGKHCEKKIPDDVDITFPGGDGSYIKHCVKGNASKEF
SISLWFRFLGRSRGVFLNLGFGCETVRPFLIMSHSSIRFQFRNQFSFVMIDNLKINNEKL
VINNGVWHHIYIALSSVTLNFKVVLDGIIVQEEQKAELSGMTFFNESGTILIGKSLLDGK
LIESGFIGDVSQVALFKRVLDSTEIAGLVRNCSRNISDSIIPWVGLMADAGPNVSLLETW
TCGTNVCPPEFTGKFCQTKIDKIPPTVVFCPSPIKVYTEESSVFVTWKEPQFDDDVAVVE
VIRSHSPNGLFSWGDYVITYIAKDAFENSVSCTFEINVTPFNCSEFQTANNSIHACGTWK
YGRFCDYKCHEKYELAVPKPPFYVCGRPGTWSHGPPTYPENPDLLVSECT
Download sequence
Identical sequences gi|449668763|ref|XP_002161897.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]