SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449669370|ref|XP_004207003.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449669370|ref|XP_004207003.1|
Domain Number 1 Region: 179-211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000502
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 2 Region: 133-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000046
Family Laminin-type module 0.035
Further Details:      
 
Weak hits

Sequence:  gi|449669370|ref|XP_004207003.1|
Domain Number - Region: 3-33
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0188
Family Laminin-type module 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449669370|ref|XP_004207003.1|
Sequence length 211
Comment PREDICTED: multiple epidermal growth factor-like domains protein 6-like, partial [Hydra magnipapillata]
Sequence
MSCQCLNNAHCDSRTGHCRCARGYYGKICEHECVSGTFGDNCLSNCSCTHSSACHHITGI
CNCTQGWQGETCNQMCSKGKYGLGCSQICNCINGGECNHISGSCQCVQPGWKGERCSEVC
EEGFFGKKCLDQCVCNFTGMSGFCDHASGRCFCSSGFLGIICNETCADGFWGVDCSQACN
CNALNSKNTTCDAETGQCECLAGYKGRQCNQ
Download sequence
Identical sequences gi|449669370|ref|XP_004207003.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]