SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449669692|ref|XP_002168857.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449669692|ref|XP_002168857.2|
Domain Number 1 Region: 69-329
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.39e-65
Family Eukaryotic proteases 0.00029
Further Details:      
 
Domain Number 2 Region: 2-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000499
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449669692|ref|XP_002168857.2|
Sequence length 336
Comment PREDICTED: prothrombin-like, partial [Hydra magnipapillata]
Sequence
LNECTAYKLGFPCHQNALCENTIGSFNCYCRHGYVGNGKHCDRINASNFDNFLNDAKDCG
ISSDHKNTSNHRVRRIVGGQDSSPGQWPWIVLIIVNKEPATIFSGVLVKPDMVLTLASLL
HDPFGKRIDAEDIFVSLGENDRNKPENNEQQFQIQTGDIYIHPEFNRTILNNDIAIIKLP
AKAKITPYVTPICLAQPKVIRKLETINSLATITGWGVRTPRKLNDIELKIQTLFSGVLQH
AELPLVNNHKCRNATPYYFNIKTMLCAGTSKNENAPCFGDGGSPLMMKNPKTKRWFLIGL
FSWSEGCAQPRSYSYFTAVAKYRHWISEIAYKNTVK
Download sequence
Identical sequences gi|449669692|ref|XP_002168857.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]