SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449671223|ref|XP_004207449.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449671223|ref|XP_004207449.1|
Domain Number 1 Region: 162-211
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000432
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 2 Region: 37-154
Classification Level Classification E-value
Superfamily TIMP-like 0.00000000157
Family The laminin-binding domain of agrin 0.01
Further Details:      
 
Domain Number 3 Region: 510-541
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000771
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  gi|449671223|ref|XP_004207449.1|
Domain Number - Region: 250-378
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000538
Family Galectin (animal S-lectin) 0.041
Further Details:      
 
Domain Number - Region: 479-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00213
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449671223|ref|XP_004207449.1|
Sequence length 599
Comment PREDICTED: uncharacterized protein LOC101241166 [Hydra magnipapillata]
Sequence
MVVAVQVLRLLWISLMLVSHTKECIKLLNRNWKQKTPAERTKDAEFVLTAKILYTTPSPR
YPQFYSATFEVLNVLKGWELIKRLHNKKSTSIISLDPKIIATANGFSDSFQLCFSSVEVG
KTYALFLGYKRETYELVAKYDDLFGAAEQLYKRTEKDILESLGWRSWNAWTSCNKQCDTG
IQTRTRSCLKESHSFCHGLSEEKRECNTFSCLTSKDALLIMKNLREESKIFADQWKARDE
ASSNTKKKSDVLSAPFNFLFPDQFPISNVLHITFKGPVKDSQFIFSIYSANNKMIMGIKV
SPFQFTIEYDQVINNAVNIRHSNPFHYSFIQEMLYTLAFVMNHENVRFSINCEELHISSL
EDELFRDADIFGSIFIGAGEDAGEESIPKVEVSHVSFSSDSESRWRQCGKIILERPQRSY
DAKGSGSDILNDGSGANNFDGDDENDDDDYEDNFDDDYNDEDEKESKNYKKTGSGNGKEC
LCQNNGKCKEDGTCTCQNGWNGDLCELPTCENLCLNGGTCVDNVSCKCPAGFKGARCEET
DKCRRYYTKLVTYSKLLTQYVEKLETIPCTDNENTLCTRKRLVSQVINKVFYRPEYVCD
Download sequence
Identical sequences gi|449671223|ref|XP_004207449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]