SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449671409|ref|XP_002154856.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449671409|ref|XP_002154856.2|
Domain Number 1 Region: 816-980
Classification Level Classification E-value
Superfamily SPOC domain-like 2.71e-50
Family SPOC domain 0.0000029
Further Details:      
 
Domain Number 2 Region: 77-230
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.34e-28
Family Canonical RBD 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449671409|ref|XP_002154856.2|
Sequence length 983
Comment PREDICTED: uncharacterized protein LOC100200766 [Hydra magnipapillata]
Sequence
MLMQIDQVVGWLLLGSFVLFFDVNKDIKVGPEEAEKATHSTGRLFQGQTIRVLIRGNKKS
RNHSPEKDDLAFDPHATRTVFVGNIEKTMMHGELRSIFERFGDVVDVDIKKMQTGQTTYA
FVQYIDINGAMFAKRKMDREYIGHTIVKIGYGRGTPTNCLWIGNLPTNVVDHQLSKIFHP
FGYVQHCLIDKRFWQALIRFETIEACTHAFAEMHGKHFQGKRLAVDYASPACRDGFYRRM
EEDGQLDRRQLEPSPTPPDAHINFQNVARGGAFQPRGNNYVFKSYAASGDSRSYAEYHPE
FGYEKGERDMYGRDKERPRGYSPMSHGSNSPKHLYSPKHTLSRESISPVSSLGFYDRKYR
NEERKRKHNYLSSPVHEGHAKKKEKRKKKDKKEKQDKDIEFGYPPVGITSPPLKSLKDAK
REKKEKKKKDKVRRKSERKQKKILKLKNLQEKLNLNEPGVDGVLSMSLQNIKPEHNFTAN
DRLHNKDTEQMKLGEIKQENDVVNALVISNYEQDNNNVLGGTKMVAVNNMETYSFDKDQL
FKTEQCNDKQVVDEIKKTVASPEEGELNEEDGKTSINQLAGSPISQDNTTNNVIKYTARL
QPVDKVLSSIPATNKVKVEVQRSSYNEESSDSSDCTSSDSDSSDSSDDSDNKKLNYKRHS
CLREDKKVFDKAREPKAYRQSNRDDFDRREHRAERDREKEYHRSKYSSSDSIRRSPSRSV
KSKSPNSSPGCYLKRDNSYDKKNVRSPYSKSPLHSLERKDHYDQHSRRTHTPPPPPPLID
KVKHPTSIVSNGQITYSRENVLPSSSTASQSADTLMDLLRRYPVMWQGLLGLKNDTAAVQ
MHFLSGNVRIAESSLPRAAQPNEVPPTLRISQRMKLETSQLEGVDKRIQLIKEHCMLLAL
PCGRDPLDVHAQTRALKTGFITYLQQKQAAGIVNTAIQSKQTTFVIHIFPPCEFAQGHLA
RVAPDLLNSAADSGHLMVLISPM
Download sequence
Identical sequences gi|449671409|ref|XP_002154856.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]