SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449672027|ref|XP_002155342.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449672027|ref|XP_002155342.2|
Domain Number 1 Region: 359-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000015
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 2 Region: 283-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000142
Family EGF-type module 0.019
Further Details:      
 
Domain Number 3 Region: 719-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000525
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 397-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000583
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 436-488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000182
Family EGF-type module 0.023
Further Details:      
 
Domain Number 6 Region: 322-358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family EGF-type module 0.015
Further Details:      
 
Domain Number 7 Region: 557-593
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000186
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  gi|449672027|ref|XP_002155342.2|
Domain Number - Region: 632-667
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00129
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 477-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0013
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 251-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0013
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 594-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0734
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449672027|ref|XP_002155342.2|
Sequence length 1654
Comment PREDICTED: uncharacterized protein LOC100210853 [Hydra magnipapillata]
Sequence
MDSNATSVLYTLKPFVNKNGQQHDAISLSPDVLIKPDFLQTNLPNKVIILNDKVPLNSLT
ISPIEFVSHDTLPSYPIVIDSTSEMVQELLKNSHPIPPPPSKSHFNIHSLNKILHNNGPV
IVENGNSNLMEEESDKSFSENMKDSENEDKEEEDLVYDDNEDIEDQDNNHDNDDDKEYHH
NNHLLLGAGASLLHKNYAEEHGSVKTIISNENGQDEKANKEENNAYNNQNFEEEKHWLPE
AIRNNQNFSAQSQCLNGGINIPISKFETQCMCPHQFYGKTCKDWNFCYPNPCSNGGQCQM
ISEIPKFKCHCKKAYIGHTCSEFNPCDPNPCNNHGTCSHDGKTATCTCTSRFKGENCAEL
SNCYPNPCKNNGRCVDMDGKFKCECQKGFIGKTCEEDDVCAKNVCQNGGSCIVNGTSYSC
QCAQGFVGKVCQDRVCVPNPCNHGGICIQRENSMFACLCPSWAAGVTCEDVSPCRMNPCK
NGARCIDAMSGFRWTLKPMQYFCDCKSPFKGAHCEINACSECHVDATCDADHCTCNLGFL
GDGKSCYRENKTEVMEVKPCQPNPCMNDGECLVKPGLLYECICKPPFVPPNCAEIDPCKP
NPCGIHEKCEVKNNIIICSCAGNMVDKKCGDSLCRTNACYNRGVCTPAGENAFMCICEGK
WGGSRCRECNCPKSQSPNNPSSWCNARGHCQCPPGFVFDESNNKCMKNKAPLVKHYKTCE
SSPCLNSIVCLNDEEGAYTCICFPEWYGKNCQHRRKCLINPCYNGGTCMEKDGVFLGCVC
LPAYLPPLCKSAHVKTMHFAHFIRAEVMIAYVPNVILDLIVLLIDAEIAMFMLIVKMGNA
LVKMDTLGPVMNAFLKDVLPNVYIFRHALKTNVTLTELQMNDDLKPTRAHPLSNYSLKTT
FSQFLITKPVRNEVYVTKIKSIPSEYQQIKIDPTKSSNSKMGFPTKIKTLEQSSLSSFIN
KKVKRPPGNPTPTSIPNQDAKTSAEVKKQETLLSALLDMPSLMVQEIAEANEDNHANNRA
PDIAGSFNNTFNKATLEILKPKPFLLDNTFIVKNINSSKNSDKKSKSKEGDSSNQVSALF
IDTKPSARLVESNTSNTSYSFQDIDSNSKTVYANKDYKNEKSLLISSFLNNDKPTINKDK
NSIKKSNDRITTIEIVLEKVNTKSNNENNQWENETNLILQKNETYKSVQEKNFQPTPFPL
ILSNVNTSNDDPGCVEKLINVTSTKDSEDKNDEVVLVEAKNDGEDIEELGLKKPNKHFLK
NDDDIPHSSGLERVHNMLENNKDVLQATFVKSEEKATPNTIPSESPVETNKLNYREDKNL
VKFLSLVEKRLKLKPYYKNHVYQPIIPPWIKVDEEKPRIVFLEGTDTNITEMRGILKHHI
LSYNKKKNVAKLGNKKDDLNNLIPLFDILSLNNQKNQLNSQYHQDSDNNQEYKPSSYYGE
VQSVATTIKAARNSQVHMQVLGDGKSYSKLGRHAAARRSKLAFIFLRLLACSDLENDLSM
LFCDSVSCEKSMFHCVANKLGLVRQLSVSDAGEDLECLDLYISEKISFIPAQREVLDVEY
IRLQIECEDLEKISISSMGTHERSLYKSLEDMKVERQAYHGNVFVASLREVTLRTIALNN
RISIVPGQKICTNCLVKLKASTEINTDNINIADD
Download sequence
Identical sequences gi|449672027|ref|XP_002155342.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]