SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449672938|ref|XP_002154309.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449672938|ref|XP_002154309.2|
Domain Number 1 Region: 2069-2179
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000542
Family Cadherin 0.0021
Further Details:      
 
Domain Number 2 Region: 1660-1756
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000104
Family Cadherin 0.0051
Further Details:      
 
Domain Number 3 Region: 27-137
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000379
Family Pseudo ankyrin repeat 0.0083
Further Details:      
 
Domain Number 4 Region: 3179-3266
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000157
Family Cadherin 0.0056
Further Details:      
 
Domain Number 5 Region: 2421-2506
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000443
Family Cadherin 0.012
Further Details:      
 
Domain Number 6 Region: 2594-2698
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000542
Family Cadherin 0.0057
Further Details:      
 
Domain Number 7 Region: 3689-3732
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000907
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 8 Region: 2317-2413
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000357
Family Cadherin 0.0043
Further Details:      
 
Domain Number 9 Region: 400-454
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000432
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 10 Region: 3370-3485
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000228
Family Cadherin 0.01
Further Details:      
 
Domain Number 11 Region: 1063-1153
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000243
Family Cadherin 0.0073
Further Details:      
 
Domain Number 12 Region: 3499-3587
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000928
Family Cadherin 0.0048
Further Details:      
 
Domain Number 13 Region: 290-344
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000127
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 14 Region: 460-507
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000144
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 15 Region: 1448-1533
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000228
Family Cadherin 0.014
Further Details:      
 
Domain Number 16 Region: 2699-2808
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000228
Family Cadherin 0.0052
Further Details:      
 
Domain Number 17 Region: 3724-3767
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000237
Family EGF-type module 0.01
Further Details:      
 
Domain Number 18 Region: 780-881
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000357
Family Cadherin 0.0061
Further Details:      
 
Domain Number 19 Region: 1548-1674
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000385
Family Cadherin 0.0083
Further Details:      
 
Domain Number 20 Region: 2797-2884
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000004
Family Cadherin 0.0089
Further Details:      
 
Domain Number 21 Region: 1765-1849
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000004
Family Cadherin 0.0098
Further Details:      
 
Domain Number 22 Region: 888-965
Classification Level Classification E-value
Superfamily Cadherin-like 0.000002
Family Cadherin 0.0098
Further Details:      
 
Domain Number 23 Region: 3657-3693
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000264
Family EGF-type module 0.015
Further Details:      
 
Domain Number 24 Region: 1263-1352
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000428
Family Cadherin 0.013
Further Details:      
 
Domain Number 25 Region: 3278-3372
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000657
Family Cadherin 0.011
Further Details:      
 
Domain Number 26 Region: 1974-2074
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000714
Family Cadherin 0.0096
Further Details:      
 
Domain Number 27 Region: 613-662
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000721
Family Complement control module/SCR domain 0.0035
Further Details:      
 
Domain Number 28 Region: 1348-1452
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000814
Family Cadherin 0.012
Further Details:      
 
Domain Number 29 Region: 1884-1960
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000103
Family Cadherin 0.011
Further Details:      
 
Domain Number 30 Region: 515-562
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000119
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 31 Region: 346-397
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000262
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 32 Region: 233-290
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000405
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Weak hits

Sequence:  gi|449672938|ref|XP_002154309.2|
Domain Number - Region: 2196-2304
Classification Level Classification E-value
Superfamily Cadherin-like 0.000186
Family Cadherin 0.016
Further Details:      
 
Domain Number - Region: 134-176
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000327
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number - Region: 1156-1249
Classification Level Classification E-value
Superfamily Cadherin-like 0.000343
Family Cadherin 0.016
Further Details:      
 
Domain Number - Region: 676-768
Classification Level Classification E-value
Superfamily Cadherin-like 0.000914
Family Cadherin 0.011
Further Details:      
 
Domain Number - Region: 1013-1055
Classification Level Classification E-value
Superfamily Cadherin-like 0.00228
Family Cadherin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449672938|ref|XP_002154309.2|
Sequence length 3869
Comment PREDICTED: protocadherin Fat 4-like, partial [Hydra magnipapillata]
Sequence
AENGNLEMLKYLHELGYKGSEWAFDCAFSKAAENSNLEIFKYFHELGYKALNSDFNCAFI
KAAENGNLEIGNLEVIKYLYELGYKGTEDTFNSAVESGNLEVIKYFHELGYNGTEYAFNC
AFEKAAENGNLEISWTLCSASCGPSGARQRTRFVQEQPECNGNCNKALKETENCNTKCCP
TNCTFTYGDWSPCIGCGLHGTRSRAKSIQSPASCGGFCLNTNVEIESCDTKRCCPVDCTV
SEWTSWSSCFAACEKTAIVTRLRTVQKQDSCNGKSCPVLNEANSCNGPTCCPRDCEYSDW
SAWEVCSGSCQGGTQKRKRSLTKQATCNGTCSNELFQTKACIVKPVKCQLSSWESWSSCS
SVNGKCGNGTQMRVRTIVVKPVCDNPCGNLNETKNCLYSCCPVNCEYGQWGKWSNCSNQC
GSGLRSREREVQTKDECGGLSCSQSDLKATEFCTENNDLDCILTKWSSWFNCSTECGSGF
SQRNRSIIQQPKCNGKLCESLFESKTCISYNSNQDCVVSLWGAWGTCQSNCSLSTMKRVR
NILSPSVCMGKKCPYLEETVPCGEVNGGCEHVCYRGVCSCSPGYTIKNQTKCVPKDCGLL
TIDLCKSSDQLCKNPSVLCPGNNTLFPTLCKLECPLGFKLFGKDTVSCQSSGQWTQTQSI
CNSLNEPPSQIILSKYDFSENLPSGFQIGVLYSVDKNKNDTHTYTLIKDDCGCFTILENQ
LKTLKVNQLLESKSLQLPLPNFQVTIRSTDNGYPPLSIEESFQLFLNDVNEKPLDILLSS
NSIKENSKEDVLVGKLDAVDVDANQTFLYRMVDSSHGLFVIDNNELKTSSRNMKCIPPTY
PQEFCPLNFEIQKVHYITIEVYDNGVPSLSFIKNFSIYLLDINDPPYNLILSSNSVKENS
LVNTFIGQFSAQDEENQTLSFLLLDDDNSNFILSSAKLYKSKSSDYEATKSHFIHVQVSD
DGDPINLVWFDKIQSIEVELLETFNGTFVLDNSTHSKCIDIKEKEAQSKCEVNLFINKNL
DFESKSVYSISIKITDRNHSIQYIFQVNVIDCNDAPISILINDTKVASIYENSFGVMIGK
LTTVDQDFEQQYEYKLFDSFEYFEIVGNILMLKKNISTDYESQSFFVISIISTDNGNPSQ
YILDQVRVNILDVNDPPTNVTLSVFEIDENLNPDTLFANVIIIDQDVKAPDYKSHPCFLS
NNTYFKIVENVLYVLMPANFEQASFIYIHLICQDQFVQVKNTFIVTVNDVNEAPSEIILS
THEYSENLPPQLIATLFTVDPDVYLDGNQHVFTYKILTNQDQVAVNESNLLAIKTFNFEV
LSLITFEIQVIDSGGLTLSQLKTIKIVDQNDPPSDILISSDKVYENSVQYTLVGSLTVID
EDQHQSFICILNGSKSSPLEIYGSHVMVAWDGSRNDHLNFEKNPLLSLPVVCTDNGNPRY
SIYKSFTIYVLDENDPPYNLTLSNYYINETDPIGTIIGKFNALDEDIGQSLSFFIVGGDS
QYFKIEAQYLIKFANFTQTGVYKIIVEVIDNAPIATVITSEDGLLVFNDNFPSINENCDI
GSVVGTIFSYDPDKNATLNITLDNTESGIFALDNKIFCYNTSSLVDGTTCKVKLLVNSYL
DYEEASFHPITIRSQDQNGLLHVQKFVITVFDMNDKPTNVFLNGLHNVAVCENIQGVFIA
DITTMDQDANQSFIYTLSETYALEVFEIDSNRLFLKSNISLDYEQESVYNFSIVSTDSGT
PQKNITVRFSVNVEDVNEAPILIEVSNLSVAENSPSTTFIGSITVKDPDNIRFVTQYHEC
WKNIVNELYVMKNGLDYEVASFFTITISCKDSGNPSLIFQQNFNISVIDVNEAPYAILLS
ANSILENTNPTVIVFTLIKLFNLGSFSTRDPDNVGSSIQLFNYTLLNESVPFEIIGHELK
TKQELDYEFQSNWIIFVKSTDNGNPSLSFIQNFTIFVIDVNEAPTDILLSSSQFEENSQK
DTVVSYLTAIDVDRLPDGRNQKYTFSLTENFKGVFRIISDQLQIAEDYNQCSKTNSCFLN
FEKNPLLQLKIKVTDDGVPDKFYEKSISVQLKDVNDPPWNLTLSSNLVKENSPIGFEIGI
FSAQEEDLNQSLTFYLINDTSGLFEIRSNGSLVIKKNPNFEMQEIYVIKVEVVDDGNPSL
SNEKSFSIFVQDINEAPAELHISDKGAAARFFINEPEIFENLPPDTVLGTLEAIDHDYVE
LLTFDLLDSHKYLRLKPNSTTCTSYTQGQSGYDDFFSSYTVCDVKVMTNTILNFEETASF
IFTVKVKDNQNLTHLQSFKLKVIDRNDAPTNITLQGKHDAFVSENDLYTAIGTLDTTDED
VNQTFIYSVINNSHFAVVKSINGESQLYTSYIPLDYEKVQNHTINILSIDSGSPALSFLQ
QIVIHVLDVNEAPSEIILSKLHVFENLPPNTVVGLLSVIDPDVLSSQTHSCSIDNFKFVI
NNASLLTLASLDYEMSSHETINIVCTDSGSPPKSLQKIFTINVEDVNESPKEILLTNNNV
PENCICVFGHFSVIDPDKDDSHNLTITSGMENFEILGSEIKSKDLLNFENRNEYLIEVLA
MDLKEDRNDPPSNLECTLTNIPETSPFGTFIGECVAVDDDNYQIHNFFITQTFASVGLKH
IPINNTVFKIDSTSGALVLGATKLNYWYSSSYVVTIMVTDNGSPQMSFEKNITIIIEDVQ
ENSLVGTFVGTVDVIDPDNFMTDKYSHFCNLTESTTFEINDNHELVVKSASLDFETTMLY
EINVTCFDLDFENKSISRIFFIQVLNINEAPSITLTPSLIDENNKPGSVIAFFDCRDPDN
LNTIVDNLTITSINSYGGQFALLFPFYLVSNIQLDYENISFYTLEVTVTDDGKPPLSLTK
NISINQFGFRKNSNCETALITATNFWYSSLNEGKLVGTLLIDLTKAFDSVPHQNLLNELA
KIGLSQKAGKLFQNYLEGRVQRVKNGNKITQWKSITRGVPQGGGLSPELFKIYMRELPQA
LTTESYLFADDITLSAADSSIEVVTEKLSKAFEDTNKFCVDYGFTINSSKTQLIVFKSPR
KKLPDNLHIKIGNVEVQPVTHVKLLGVTIDQHLQFKEQIDSTVKKCHSSMGILAKASVRL
PRELLKIAYTGLIRSQLEYASILYLGQSKAQLKRLDVIQKQCVRIINNLNEAPTSLSLSS
TSFYESQLPGTIVTSIFISDPDPNQNHTCKILDDANFFSMNGSADIKLTNKVDYETISFL
SIVVECFDNGSPPLSIKQNFTINILDSNDQPSAINYNISSVLENANFNQLVAQLIVEDQD
QNQSHLCEAQGTNKHWFYFSNETNGKIFVFLMSEIMKLNYETEKSISVIVICHDNGTPPL
SIQDRFEFFVIDVNEPATKIFISNSSFIFMNENVVPGTRVGLLECDDPDVGQEIKYNLLE
DSNLKFQIYNGNILVVKNLSMFDFESSEFSRVIVNIQVSDTSNQPIVYNGTLEIIAQDVN
EPPSNIKYIVNNLISDIHFIGENSTIGSSIGLLLADNPEGSVQMLTFSLLTYKNYFLISY
YNNSSSDLVLVKELDVNDISDFTISVKVSDNGIPPLSTVGYIRLTVLRSDPCVSGMMHCT
SNSECARKNKTTGECLCLPGFEMNLGVCQQIDDCKPSCQNCLVSSRNACLKNNALECSPC
RNDGICTDLHMNYSCECKKGFTGLDCAVDIDDCAPKPCLHNSICEDKFNNYSCHCAPGYK
GNNCEVEINECEQNPCYNGNCTDQIDGFLCTCPLDYYGTSCQRYSKFCTLDKCSENFECV
PNPISKKSEITFRCVPKNRILSLFIEDKFAVLSPDTAVSLWKLRFENFLLEKVTVPSPWL
ESKVYDKYVECKINDAFILNYESVPQDVL
Download sequence
Identical sequences gi|449672938|ref|XP_002154309.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]