SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449673900|ref|XP_004208058.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449673900|ref|XP_004208058.1|
Domain Number 1 Region: 433-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000112
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 2 Region: 397-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000752
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 3 Region: 362-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000262
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449673900|ref|XP_004208058.1|
Sequence length 505
Comment PREDICTED: uncharacterized protein LOC101236921 [Hydra magnipapillata]
Sequence
MQYLGKQWIFIFLVIIYLNWTQCTRKIHHKGIDSAKKHKIKSKYNLTNVFDQLQPEIVKY
RDNKTESKKFDILQQVYNRLAHSQNGVPQYINIPGAVHVYGPPPNVPAPMEPFRVIATPQ
LTRLHSYHNIGWNSHENPRHFEQFTNKHLQKFLNYPNRIFIPQRKEFNDASYFQNRYIPH
NALRQHQLSQLFHENELAANPFANTLQQHINSGINTLNAQNYLPQNYLPQSDVPNIEQSS
ISNINLNNVGVAEKIGMMTGGELPANEITGGGQQPIFSPLEQPNIIPTDLHTLQTSAPRY
FPEGKVTVSLPQKSDRNEQSFYDGAEASIPQQNLINLQPQPVQKISHLYHSHHLTKHLRK
ARCYPNPCRNAGTCTALTHGHICTCSIGFKGKHCEALNQCQPNPCKNGGQCYETPEGYKC
GCTMGFKGDLCENVDRCRPNPCHNNGKCTETEEDFHCTCNTAFIGKNCEMFLFLFVSESR
VGCAFFFYWRLKQGCSYLKCETSLV
Download sequence
Identical sequences gi|449673900|ref|XP_004208058.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]