SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449673902|ref|XP_002157825.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449673902|ref|XP_002157825.2|
Domain Number 1 Region: 810-851
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000998
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 2 Region: 450-488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000221
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 885-927
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000331
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 4 Region: 489-525
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000243
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 598-633
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000042
Family EGF-type module 0.012
Further Details:      
 
Domain Number 6 Region: 768-804
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000527
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 7 Region: 525-568
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000377
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 671-709
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000508
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 634-671
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000903
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449673902|ref|XP_002157825.2|
Sequence length 995
Comment PREDICTED: neurogenic locus notch protein homolog [Hydra magnipapillata]
Sequence
MFLLISLHITVLLIWRGNADTTEKKNTRYVEPRSNQNQPVVYHYGHILGYVTAHRRSISP
NESKNSTGNFLTTVNGELEDNFVSNNSYVDENEDSKEQGGEINKLNVQVRISKDDVKSNV
KIFDKFEIPIYHNGFDEPKTVDEPKQKKQRKRGKFCTKFFSPKCLLKHKFRGKLFYNKNH
NDLPLRVFNESESLFDIRKYSNKNTTDDDSNQDYFSLDQTKQLFNGLNQTSKLPLNILFP
NRTIYKKYIPFSKRRFLILQKLRRNYSLKHCRSCNHSVKNIVAIRNDQNILNKITSSKHR
HFQNTSTEDLKRGGIRTITPRHHDNSSVDFVENGNEVTENNGRNQVINPIEHDITIHSNN
NDLEIPGKEVNLDSQNISDLDGRDWNEIVSGIREASPEYNRQNDDTNFDTDIMLTHHIKK
GLHSLHPSGSFHVHTAPDHLNIHVHEYDSEIDHCHHSPCENGGQCTSTLTGYSCSCPERY
TGVTCKEHLGYCDPDPCQNSGKCLDLEYGFKCSCPPGYHGEKCQEFSHCYSSPCNNFGAC
IDVNHDFQCICPHDYFGPTCEHSHNSCSRCDPNAECIKGICNCLSGYIGNGRVCEVASRC
HPNPCENGGSCLDKDIGFECTCASGYTGNKCEEMNPCFFNPCKNNGHCNYIGHGDYQCHC
LPNFLGKTCEDHSPCNPDPCMNSGRCSEEGTNFQCICSVQYKGQYCEVDSCSSCDPFAYC
EEGFCHCKSGYVGSGHHGDCKPSYVHISVSSIQPAPATPPAEEKKVVSHCTPDPCLNGAT
CIDESTGNYKCICRVGWKGRLCQEKEEKAFDPCVPNPCHNAGTCINEGDSFTCKCAKPYT
GKYCEEEQKAVLSPPLPISTTTPITVLSPGVPQPFVAPSAPTFLINTNPCHPNPCQNGGT
CHDFDMGRNYKCICSVGYDGSHCQEDICAECDLHATCSHGRCRCKTGYFGDGYECTKVIC
DHCSSHATCLNGVCHCNDGWSGDGYHCTSGLNSYF
Download sequence
Identical sequences gi|449673902|ref|XP_002157825.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]