SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449674332|ref|XP_002165286.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449674332|ref|XP_002165286.2|
Domain Number 1 Region: 278-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 2 Region: 719-770
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000198
Family Laminin-type module 0.007
Further Details:      
 
Domain Number 3 Region: 933-974
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000237
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 4 Region: 437-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 5 Region: 332-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 6 Region: 721-878
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000408
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 7 Region: 390-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000949
Family Laminin-type module 0.027
Further Details:      
 
Weak hits

Sequence:  gi|449674332|ref|XP_002165286.2|
Domain Number - Region: 981-1021
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000173
Family Laminin-type module 0.01
Further Details:      
 
Domain Number - Region: 94-170
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0153
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.061
Further Details:      
 
Domain Number - Region: 898-927
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0226
Family Laminin-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449674332|ref|XP_002165286.2|
Sequence length 1037
Comment PREDICTED: laminin subunit gamma-1-like [Hydra magnipapillata]
Sequence
MNFSLLSVFISLNFVSYIFNQDVEPEYGRAIQCKRDDGVSQRCMPVFENIAFDKDIVANN
TCGLHKPEQYCVQTGTSGAKKICDYCDDKNPGQRHPANLMTDIKLEENPTWWQSETLLEN
KKGVHLILDLKKKYHVAFIRIRFHTIRPHSFSIYKKSTYNPNEEWVPYQYYSRTCEETYG
VPNKATVSISNQKVALCTDEYSGLIPLSGGNVAFLTLDNRPGKSEFDKYKELQDWVTVTA
LKINLDQLNTFGDEVFGDPKVLKSYYFAVSDIAVGGRCHCHGHASTCAHLQGKLYCECDH
NTAGMDCEKCLPLFNDRPWRAAQDSANPCKACDCNGLADECVFDEQLWIDSSYQSGGRCI
NCQKNTAGIHCEKCKDNHYRRDGEIACHPCGCNKVGSRTSSCSSEGRCVCHSGVIGDKCD
QCKSGYYDFSPKGCSRCDCDVQGSIGVNCDATGQCQCKENVIGKRCNQCAPNHFDLDARN
PKGCKACFCYGHGISCEGVKGVGKKIITSSFDSDADGWTLQDELGNDYSKNIQWDSNGRY
VLIKSIPNKVLYMVAPKKFLGNRLSSYAKSFSFLYGIFLQNGDPDLQTSDKDIIFEGDGE
VAYFSISHQNNNKPAGRFINFEYILLEPEGMPTFDFQKLLSNVTAIKIRVTYLYPRSGAI
NDIMLESTQYVSPDSDGQVFWQEKCVSKQGHTGDLSENCEIGYNRAEPGSGPFGKCVPCR
CNNHTNYCHPETGECKCEDNTSGKNCENCLEGYYGNPTNGHADDCKLCPCIFGSQCILIS
DHIKCTNCPVGHTGDLCEICDDGYFGIPTKNVKSSRCQKCDCNENVDLNAIGNCDHKTGE
CKKCIYNTMNGPEKKCELCSVGYYGDALAEPKGNCTACKCFESGTIVPLGFKSGDPIPCD
SNGNCQCRKNVLGKQCNTCPSGHWNIEAGCEKCECNQIGSIGNECDIKTGSCKCKPGVTG
RKCDQCSTGFYQFSLTGCEACNCHPEGSKNQNCSSTGICDCLPGVLGLKCDKCPENKYNL
SLGCTGQVDFGGLNFKS
Download sequence
Identical sequences gi|449674332|ref|XP_002165286.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]