SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449675609|ref|XP_004208452.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449675609|ref|XP_004208452.1|
Domain Number 1 Region: 3-239
Classification Level Classification E-value
Superfamily Kelch motif 3.34e-40
Family Kelch motif 0.01
Further Details:      
 
Domain Number 2 Region: 472-519
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000146
Family Laminin-type module 0.0071
Further Details:      
 
Weak hits

Sequence:  gi|449675609|ref|XP_004208452.1|
Domain Number - Region: 288-316
Classification Level Classification E-value
Superfamily Plexin repeat 0.045
Family Plexin repeat 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449675609|ref|XP_004208452.1|
Sequence length 713
Comment PREDICTED: attractin-like protein 1-like [Hydra magnipapillata]
Sequence
MTMRASHAMATINSDLFIYGGYSFDNGKLDKLIRYNLETFNFVEYETSLQNRYDHSMVSY
GDKLIIFGGVLFSKDTNKTQVTNEIRKYETITNSWSVVNPIVLNGDFPIAVYGHASVVVN
GVMYTFFGYNDKEFIHHVQTLDLTTNVWTLVKTTGDVVSGSYKHSASYDIQTDTVFIYGG
FRNNKKITSQLLLFQVSSKNWTIGLSSKLPLMLHASGIIGRNLLIYGGIANNSSNKNTIS
ECHSKDTLVYNIDCKSWSVISGNLLLSNGRYGHAIVTFNNFLLNLLGDCSQYTNQEMCLS
APLIVGCLWTNDGVCIELNTLLPESSIKRPICTDICSTITEGCLACTSFGCGWDSDKLLC
VKAPLLKDSKVIISYKDCKDMCSILSDCNACKLMSNCRWTNQNNCVNAALAKSDVKCELQ
VTCQKCFQLPGCGWCDDGSGRGLGWCSKGTDNGSFNNACQKKNWYFTDCPACNCNGHSKC
LNGTNDCGVCEGFTEGINCEKCKFGFFGNPENNNSCEECTCNGHMQDCNPEGTCVCNLNG
ATGKYCDSCDKNGFVGNATNGGFCYFKLSVDYEYPQNLSRYTVAAYSVKPNLKITVTQPG
AVFDLVYFLIMFMVCFCSLVIIMIILWKVKQRYDIYLRNREHSCVAFEPFANQLYGVASV
LVKLPCGNSNFTPRGQCGLCIGSTVTLMPQRWSLSHIQKHSQYKKKIIHEVSV
Download sequence
Identical sequences gi|449675609|ref|XP_004208452.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]