SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449677266|ref|XP_002156630.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449677266|ref|XP_002156630.2|
Domain Number 1 Region: 79-215
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000073
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 2 Region: 219-358
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000942
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 420-460
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 4 Region: 380-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 458-512
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000106
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Weak hits

Sequence:  gi|449677266|ref|XP_002156630.2|
Domain Number - Region: 21-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0559
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449677266|ref|XP_002156630.2|
Sequence length 674
Comment PREDICTED: fibrillin-2-like [Hydra magnipapillata]
Sequence
MVYYKRIIWLVCIWFISGTYSDCQTSLCSNVANSIVNCSSVSTTYECQCNPGYYALPNTW
VNGNMSTAILTTLQFPRQCQDINECEDPSICAENSECVNTPGSYECICKNGFVGDYAVSD
KRRTCYDVNECAQRASLCPTQTVCVNTIGSYKCQCGGGNQTNPITGACEDVNECVPNGVT
IFNNPCDRLLPITLNFTTCINTIGSFQCVCPDGYLSPRPEDFYTCRDLDECSMNQNNCSV
NSICNNFGGGFNCTCKSGYITSSSGVETLSDQCVDVDECYLGISDCDLDNGNCINLDGAF
SCNCNPGYVSKANVSSYSCIDENECITKGCYNSISVNATCFNEVGCFTCTCPQGYTGNGY
MLGTQYLSAKGPVDGTGCNDLDECLQNPCAPNENCTNTIGSYNCFCDPQFFKITEYNECQ
DIDECALGTATCPKHSTCQNKNGGYTCVCDKMYSGPQCEFDGYWSEWQNIGNCSVPCGSG
VVQQVRSCLLGSNCNPYPVGYNRTRICNTELCSNVTSLVKSCWCENVTRFLNDAELQEYS
NQNNVEVNKNKQAVVDIFNKWTAYPIDEVCFINKLKNSLTAITSDITFVENYANFTIGLK
TRLANIIHCNANMGIRSSLTMSYRELHEKKMLAFSLLNEIRLKRDDLTKKMNYCLSSGFL
NTLWNSVTATFRSF
Download sequence
Identical sequences gi|449677266|ref|XP_002156630.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]