SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449678446|ref|XP_002168273.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449678446|ref|XP_002168273.2|
Domain Number 1 Region: 417-545
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 392-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000324
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 3 Region: 29-69
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000901
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 106-147
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000019
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 582-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000191
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 6 Region: 68-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000572
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 351-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000803
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  gi|449678446|ref|XP_002168273.2|
Domain Number - Region: 318-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000937
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 550-678
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00989
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449678446|ref|XP_002168273.2|
Sequence length 859
Comment PREDICTED: fibropellin-1-like [Hydra magnipapillata]
Sequence
MPLPYIFFIVSIYNEVYGSIEDLPLIYRGACISNPCLNNGLCTITPNGFLCTCVGGYIGV
QCEKRADECPDDNRVSCEHGDCRLDLSAQPRCMCNDGYQGLNCDEKIDSCISNPCFNNGT
CISKTIGYECQCLSDTYGVQCQIKKENILKCVSSCDGFANDGRCWHETAKDVIVGWGYGD
YICNTKKTCFNLSSSTSDKHDYIEVQLKPIHMQNSDELVFVTDIDSELYGYNFIPHILPL
ETDSELAFKSCNITNAQPITNIQNVNSKLNVNASLLVIGTQYFIADFNEIHRCVLGLRLN
VTVKDKDCHDPSNLTGLMCNGRGKCYSDFNMRSFECLCCEGFVGKYCQYEDLCFTNPCKH
GVCKLEEDEDGIVTHQCECDEGFDGATCNQRTNACESNPCLNNGWCIEQGSRYKCQCLNG
YSGVHCEKKFDYCLSRPCLNGGSCKNGLKDFHCDCLPGYKGTICEINIDECAASPCLKGT
CLDTINNFTCACIAGYVGRLCDVVLNECSSSFCENGVCVKQNEEYSCSCGIGYTGMHCEL
KVDLCTFSNFCIKNNADSCEDHGSNVSCVCKSGWSGSNCGINFDDCLNNKCTNGARCVDK
LNGYDCHCPYGFTGMFCEIGPPKQNTDIIIEFTTDSCQMLLNDLNHVTANTFNILGNLCK
CNTDNDLLLQESKVLCKDETSGIFKATLKINNLQWETNIICSLQKSLQKKEKHLIYNNTY
IHSVLNSNEKCIDLYVEANMARKVGSADNSNNTIGVVVGILVGLSIFIFSLFIWCVKLRN
NRMKVGTLHKFQKEDITFDNPAYAGETYNENETICECCESTDFQETKWAHKYDSSRKLFL
RERSVPAGRLFDLHTKDEN
Download sequence
Identical sequences T2M937
gi|449678446|ref|XP_002168273.2| XP_002168273.2.79663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]