SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449678542|ref|XP_002160645.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449678542|ref|XP_002160645.2|
Domain Number 1 Region: 826-870
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000181
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 2 Region: 103-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 3 Region: 206-255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Laminin-type module 0.0089
Further Details:      
 
Domain Number 4 Region: 5-49
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000128
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 5 Region: 54-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 6 Region: 258-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000642
Family Laminin-type module 0.031
Further Details:      
 
Weak hits

Sequence:  gi|449678542|ref|XP_002160645.2|
Domain Number - Region: 152-203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0586
Family Laminin-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449678542|ref|XP_002160645.2|
Sequence length 872
Comment PREDICTED: laminin subunit alpha-like [Hydra magnipapillata]
Sequence
MVLNCECSEQGSITNRCNPTTGQCQCRQGFKGMNCNECVMSSASFPDCLLSVKCNCDKVG
SLSNSCHPSTKQCLCRQGFRGRICNECAVSNASFPDCQSSIKCKCSKDGSINNICNPLTG
QCQCRQGFKGKTCDECVISSMSYPKCYSSDKCKCNIDGTLISYEKYGPCTVDSCMCKEYV
TGNDCSKCKNTYFNLTKNIYGGCSKCGCLSAGTIGNIKLCDETGQCLCRPFVTGRTCNKC
KPGYRSLDRRNYFSCTSCNCNVGGSVSKTCSENGHCKCKPNVEGAHCDKLKTGDFYILSY
FHNIFEIEDADTLDGSKLQFQYSDDEFVNFTGKGYVELGKEKLHAIRLHIVVPVSKEYQI
LVQYKLNYTESAILFIDITRKENPMSYGATANFHSSTEPTFASLWNSNQTKIFFLTAGTW
VIDMDFSFFKTVLVDHLVIIPEDYYTGGDMQPDAVLPCSIKMHLSKECMLYKYIDLELQH
FQAENGYVKKIGNTNLSKTETLNDSSTLFHLISMGDMAVISRKQITLTMNIAVQKADEYF
LVVTYFNTDEHTHFVDVYEDDTGFRGYLEAVPCSYIFLCRLVVLNADGYPVTLKLLANKS
VEITFLGNLRGNIAIDFVTLIPKAVWSVEYIVPTEYCYMKERKCLDKVAFKNLKNSITIQ
PTGKSNQSFPFHLIEKVNFFGTAILGQDVETYFFIFQYSQKFSTFKVTITIIDNSNNLFV
FNTNVHSCLSIAGCRGFVAVGNLSGVIDLKISIPDGKEIWISSMFFVHESYFDDDLLVLK
RTEFKEKFEKLCVDSNNIPHIQPQTPFCADAQFTLTTEFTGKTYRCECDKLGSKFSSCNK
IGGQCACKEGVVGRTCNKCKKGFYGFPRCQRE
Download sequence
Identical sequences gi|449678542|ref|XP_002160645.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]