SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449678828|ref|XP_002158020.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449678828|ref|XP_002158020.2|
Domain Number 1 Region: 252-411
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000209
Family Growth factor receptor domain 0.00064
Further Details:      
 
Domain Number 2 Region: 183-316
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000018
Family Growth factor receptor domain 0.0076
Further Details:      
 
Domain Number 3 Region: 408-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000689
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  gi|449678828|ref|XP_002158020.2|
Domain Number - Region: 141-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449678828|ref|XP_002158020.2|
Sequence length 479
Comment PREDICTED: cysteine-rich with EGF-like domain protein 2-B-like [Hydra magnipapillata]
Sequence
MAYFKISCFNLKVFCKFFFVFWIVIKMHLVTGKSRVETTCQTCRDLVKNFNLGMEKTAKN
HFGGGDTAWEEENLKSYARSETRLLEILESVCNDVSKESTCHAMVEENEELLESFWFNKH
TELSSLETFLCIEKLKDIIFIECPGGASKPCNNRGTCKGSGTQSGTGECECNTEYTGPEC
EDCKDNYYKDGLDCKKCHKSCKSCNGSTNQECESCADGYIMDDEKRCIDIDECERKDICK
VGEFCFNTEGSFRCHHCDPACKDGCTGTGRLSCTNCSNGWTRVELTKACEDINECDQEAI
CPIGTYCINNPGSYVCEPCHQACSNGCSTAGPQSCNACAEGYMLSEGNGCVDINECLEKK
VKCSSGQICVNRDGPDSCENCHSSCLECSSTGKSDCLICKSGLALINGQCDDINECMDNP
CNSKTEVCTNNIGSYKCTCKHGFARSKTSGQCIEKKKGKDIKSEEKLEVTTPSDGKAEL
Download sequence
Identical sequences gi|449678828|ref|XP_002158020.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]