SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449680587|ref|XP_002164519.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449680587|ref|XP_002164519.2|
Domain Number 1 Region: 11-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.77e-61
Family BAR domain 0.0000011
Further Details:      
 
Domain Number 2 Region: 278-356
Classification Level Classification E-value
Superfamily SH3-domain 8.14e-24
Family SH3-domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449680587|ref|XP_002164519.2|
Sequence length 359
Comment PREDICTED: endophilin-A3-like [Hydra magnipapillata]
Sequence
MSLAGLKKQFNKTSQFLSERVAGTKGSQLEEEFKELERKIDIVTKAVDDLHNKSREYLQP
NPSARTKLAVQASYQKARGQTKSAKYPQVEQNLADVFLKAGADLNDELPYSQSLMACGNT
FTQIAEIKDSLEFSVKQNFLDPLYQLQQKDLKEINHHRKKLESRRLDFDYKKSKGAKVPE
EELNIAEEKFTESKELCYNSMMNFIDSDVEHIGQIHAFAEAVRDYHHQCADLMDALVKKL
AENLSEAASRPKEDRVFISRPKFDDSGSLNAYDIVEKSSPLTTPTPPQRSAPAAPNQKSK
MPCCRAMYDFEPENEGELGFQEGDVIELTSRIDENWLEGRLKGQIGFFPQNYVEIIVPL
Download sequence
Identical sequences XP_002164519.2.79663 gi|449680587|ref|XP_002164519.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]