SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449682682|ref|XP_004210145.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449682682|ref|XP_004210145.1|
Domain Number 1 Region: 505-635
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000455
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 180-232,453-535
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000879
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 622-666
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000569
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 814-850
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000152
Family EGF-type module 0.024
Further Details:      
 
Domain Number 5 Region: 765-798
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000762
Family EGF-type module 0.028
Further Details:      
 
Weak hits

Sequence:  gi|449682682|ref|XP_004210145.1|
Domain Number - Region: 856-914
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000314
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number - Region: 665-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00196
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 706-747
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0367
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449682682|ref|XP_004210145.1|
Sequence length 1048
Comment PREDICTED: uncharacterized protein LOC101240899, partial [Hydra magnipapillata]
Sequence
MMHSIKDVTEVLCRALFWVMQMCFISITGSIINDSITDSVNMQCPEIFYDSVLNGFHNRI
VACSFNNHNCSVQNNGFIYSIDIPSTNPPNNSFNPSNGVGYIYGKSASTFRLNVLGSHYT
NIHNFDIYITMALYTESGNKSDFGLFDSLKSFSTEFSSSAYKWDVINIMYYLTDTEMSSV
CKEEYTFNAALNQCEDPCAVKYCEYYCNAVSGNAVCSCPAGYILHSDSTNCLQANPPLDN
GAAYTTFVRGVALDNTTFTSSYSSIVITKDVTTTTSPSTTTTTSSSTTTTQYPTTSTQHP
TTTQSITTTSPPAIAVTSQSFQIVVKSFLTVQVITYIEVIIRKQTDFTIPTKPPSQYTKE
DIDNHVDGWYRFASTTVTATQISSITLSSKYGNSIMVNSGNSKFNRKRRSLDDSGFVLDD
GTLFSVFIIASTENSTLTSPYYPVVLTVDPDSLCASISCFKYKNQICSLVNSTSAKCFCQ
NGFITFDDYLTCEDIDECSAVANACSFENSLCTNVPGSYSCSCKSGYALSNNRCKDINEC
NLLCKSPNSTCTNRIGSYECRCVAGSFYNATFDSCQDLDECRMGTALCDTVRGTCQNQNI
FATGIPYNCSCPNGWQLSKDGTNTCIDVNECLNFCNGPNAFCINTIGSFICKCAVGFSLN
SSFQCEAVNLCSQINCPASSNCTFISPGYFGCTCKPGYLINYISSCEEIDQCLSKTPSCL
KPHQICQKGVDSLGFTCGCRNGYENISGECKAITTNICNQALSNNVSLCPSGQLCFDLKS
SYECRCPSGYIKNSSDQCEDSTYAGYQYNFGLYVNECLLDKSCTGNAECINYNGGYDCEC
KPGFSGKNETHPSAKVCYEDSAWSSWQQVTKCSMPCQTDQKRGKIIFSRFCILNGPGTCP
GNATKEEFCNSDYCDNKIKVLKSVQCENWKNMEDLIDLPFKDENETWFFEIRKWLGFHIN
TAECKELASIKASIQVKLESLQMEIIKIKDIRLLLRKVIDCNTYLQKINDLRQKYKRVQS
RLVMYTTVKAALKKLQDRMNLKQNKCIN
Download sequence
Identical sequences gi|449682682|ref|XP_004210145.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]