SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449683277|ref|XP_002155677.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449683277|ref|XP_002155677.2|
Domain Number 1 Region: 921-959
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000602
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 2 Region: 425-461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000822
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 812-848
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000357
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 886-921
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000771
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 626-660
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000286
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 587-623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000786
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 7 Region: 736-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000286
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 462-502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000288
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 959-995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000112
Family EGF-type module 0.012
Further Details:      
 
Domain Number 10 Region: 850-884
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000013
Family EGF-type module 0.014
Further Details:      
 
Domain Number 11 Region: 551-585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000179
Family EGF-type module 0.01
Further Details:      
 
Domain Number 12 Region: 774-811
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000206
Family EGF-type module 0.016
Further Details:      
 
Domain Number 13 Region: 382-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  gi|449683277|ref|XP_002155677.2|
Domain Number - Region: 498-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000153
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 996-1018
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0021
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 1199-1218
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00573
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449683277|ref|XP_002155677.2|
Sequence length 1220
Comment PREDICTED: neurogenic locus Notch protein-like, partial [Hydra magnipapillata]
Sequence
DDPLSNNIRYTNIRNIRKTFICLTIVNRSWYTVRNCGKLAATRSNASCIDKEPKFRIADE
KNHIGNLRGVNDENFQSIITATNSEDRLHKNELKKRSGFNHSLPEREQEHIGERRKDIPV
YKNKSFSDINSFRLHAKKNARKTLIPMNQSVAYDTEDNHDGILLDTDDGVDTIPDTISEP
DDKKEDNYVEDDHFDEGVPPHYVSRRFDVYRKTHMNGSPHRHQPHHKDHGFVYRKGSHSF
HSGSKRQFLPQSWIQNGANFNRAPDDMEITHANLFNNVPQEYVDADPGKVNTAGPRVPPA
NMVNSLGEIVDIPDQSVNPNSAAIDEQADSQRNGYSVKEIPNQLMSSLNPTEYAPYQDHE
LDHQWIDYKLPQHHINHHSHFYNPCSHHPCLNGGDCHYSHARKTQFKCVCKKGFSGYYCE
KSVLSCHPNPCQHGGTCTKTTDGYFCTCPSDYKGHDCETPVECRAGFCQNSGLCVELANG
FSCQCQKGFSGKYCDEKLSRCSSQPCKNGGVCKDIEEENRFECVCLSGFGCPDCSCPSGS
EQANKASMSALCPTGWCKNGGTCLSTKTGFTCNCPTGYHGLDCAIPDLCSPNPCDNGGIC
VQDEDENYKCICPYGFKGADCQTPLSCQTHPCANGASCSETLDSFTCKCNPGYKGKKCKV
TSIVKKHNLIGTVASVAGRGCKRKTTSAIDQNIIINVKKNRFFLAAKLAFIIQKDHNITV
TPQKIRNPIREQGYRELNPCAKNPCLHKSICLEKGSLYSCQCHSGYRGKDCLEKDPCVPN
PCGSNGKCLEISSVITCNCSVGWMGESCDISDLCQENRCLNGGTCVHSTDQFKCLCPENF
HGDRCEHETPCHMNPCMNSGVCEAVGSTFVCRCGSGFHGSKCHLTSHCYPNPCHNGGKCF
ESEESYICECPHGYSGKFCEEQNFCSSNPCMNGGRCIEENESFLCRCLEGFFGHLCEENV
CDHNPCLNGGRCIPANNPLGFLCECIFPYHGHHCADTDPCVPNPCANGGTCQSHLPRFND
VNDRTVNVVSVVEPVFNSSIFNERNEQGQADLNARRAVSHFHFKDDDKKDSDDEDDTELH
HNLPRNSQQISLFTSEKQMEDSDYDFNAKGDFKSDDSKMNMDIEKRTIGLSSNKKYLYGT
LNQSERIRRNQHSPRLLHNLFKRYDISRNPKLALQLKKVPKILFTIKNATTSTIIKRSLH
DLYVCQCIGGYLGAHCQRML
Download sequence
Identical sequences gi|449683277|ref|XP_002155677.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]