SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449687544|ref|XP_004211482.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449687544|ref|XP_004211482.1|
Domain Number 1 Region: 261-442
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.45e-30
Family Laminin G-like module 0.00094
Further Details:      
 
Domain Number 2 Region: 741-929
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-28
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 3 Region: 496-673
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-22
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 4 Region: 168-261
Classification Level Classification E-value
Superfamily Immunoglobulin 6.39e-20
Family I set domains 0.033
Further Details:      
 
Domain Number 5 Region: 88-180
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-18
Family I set domains 0.014
Further Details:      
 
Domain Number 6 Region: 9-91
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000081
Family V set domains (antibody variable domain-like) 0.06
Further Details:      
 
Domain Number 7 Region: 428-470
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000031
Family EGF-type module 0.016
Further Details:      
 
Domain Number 8 Region: 681-722
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000008
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449687544|ref|XP_004211482.1|
Sequence length 934
Comment PREDICTED: basement membrane-specific heparan sulfate proteoglycan core protein-like, partial [Hydra magnipapillata]
Sequence
PPLIIAASETVFRVNLNSSITLKCNVSGYPSPFINWIFPDGSNGASNSYGEFALVNMTKY
DQGQYKCRASNVGGFAEETFTVLINELPQVVILEGTHMSANYGSHVSITCKASGVPLPTV
QWSKRQENITKNIKTENGVLNIYNVTSEHSGTFRCVAKNDIGSVLSEVQLHVKGAPQVSV
FPSSLSVSIKELVKFSCNVTGHPKPKVTWLKLNGVLPNQIYISEDFLVIPSVKVSDAGVY
LCRAENLQGTGEASVTLKVLDFVPHFFQEDSMQVFENIPNTQSQTKINIWFKPDKPDGLL
IYRGSSVKDFLSLIIRDHYVIFCFNLGSGSAIIKTTNRFELHRWVSVEAKQDQSIGFLKV
NDDNPVYGKSLGRFNELNLDNELYLGGYEDVTKIVANVGFITSFSGCVSELIVNNQRIEF
VDAITSKNVASCNTCHDNPCKNSGICNPSRTKFGFVCMCMKNFTGVYCEDEVERCYPDAC
LYEGQCVNHEKNGYSCKCLLGRFGKRCAHGFSISVPLFNESSFLSFHIPNLRSKVLTISF
SFKVQSVKDFKVLSIEQTFQNKFKFLNFAVEKGSLVLNYNLGDGTVILNSEKKVILDQWL
EVHFELKGKYSSLSINGQQALKNVSNGLEDSLNLNTNTLVYIGNGLIGCLRQLVLNSKKI
DLSKEYVAAKNILSCYKLASLCLSKSCLNGGTCVMVSDDDFICKCTNSYDGILCEKKIDL
CENYIDCKNNGICKKTSHGSTCFCPLGFSGLSCQQREFLNNSAKLTQNSYILFRKVRIVE
KSRISFLIKTVREEGMLLWLGQKPDSAFSSAFMLVGIKKGTLEIQFELGSKLVIGFSKLK
VNDDRWHSIGLLRQGSTLICMIDEKDSFTLDAGEINVSLDFFAYLYLGGGISTRSLSQGK
YLRSYEGCVQNFILDGDVSFVLGPDEAWNILPCE
Download sequence
Identical sequences gi|449687544|ref|XP_004211482.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]