SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449687752|ref|XP_004211534.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449687752|ref|XP_004211534.1|
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000926
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number 2 Region: 118-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000603
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 260-381
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000235
Family Growth factor receptor domain 0.019
Further Details:      
 
Weak hits

Sequence:  gi|449687752|ref|XP_004211534.1|
Domain Number - Region: 165-212
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00254
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 214-267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00378
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449687752|ref|XP_004211534.1|
Sequence length 422
Comment PREDICTED: fibrillin-2-like, partial [Hydra magnipapillata]
Sequence
INECTRTNPPCAWSNGVCMNTNGSFFCSCNVGWALGQDNASCVDICEGCEENKNKVCDVK
SATKMLCLCKNGYFSLDNMITCIDVDDCASGINSCRDNSICVNTDGGYNCTCPIGFILTN
DGMGCQDVNECLQNKCGFDVNVTCVNKVGHYECICPQGQFFNSSVLSCQDINECLFTGAE
YPCDSVRGHCENRPFPVKYVCSCPTGWSLSSKNICTEVNMCALGFQCPNNSVCTMPVPGS
VSCQCVNGLMMDYSSNCVEINNCNGPNMCYDKPHSKCVNKQGVGMWNCDCLNGYQAVVIL
VDECKIAEQANKSLCKLNQQCIDTTSSFECRCLTGFSLVSTGDCEDINECIVNKTACQSN
ADCVNTYGSYNCKCKIGFVAENVTNSSLMHCYEVEFRVFKDKPFRIRGAAIQKEFEPKEI
IL
Download sequence
Identical sequences gi|449687752|ref|XP_004211534.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]