SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449688514|ref|XP_002155794.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449688514|ref|XP_002155794.2|
Domain Number 1 Region: 401-450,605-712
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000000000326
Family Hermes transposase-like 0.02
Further Details:      
 
Domain Number 2 Region: 54-195
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000022
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 185-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000536
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 4 Region: 356-393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000746
Family EGF-type module 0.023
Further Details:      
 
Domain Number 5 Region: 270-395
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000753
Family Growth factor receptor domain 0.018
Further Details:      
 
Weak hits

Sequence:  gi|449688514|ref|XP_002155794.2|
Domain Number - Region: 12-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00363
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 546-599
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.034
Family Myosin rod fragments 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449688514|ref|XP_002155794.2|
Sequence length 713
Comment PREDICTED: latent-transforming growth factor beta-binding protein 4-like, partial [Hydra magnipapillata]
Sequence
MPSVRGKLEKTPCVPIDCHSYKNQTCSLVNSTYAKCYCKNGFISFDNLVTCEDINECLSV
SNVCYKNSQCTNLIGSFMCSCIDGYKFKDYSNGCVDINECETSCNTSNTTCINTIGSYEC
RCNIAGSFYNTTLGLCQDLNECSSTKPCDSVRGICYNQDIFETGKPYSCSCPSGWELSKD
GNNSCVDINECLTLCSGVNAFCINTVGSYKCSCAVGFSLNASSQCQLNNCSCPLNSKCAV
NGTINGNFGCTCDFGYSPNYMSNCEVIDQCEGTKNCMKPHQFCQNVYSNFSFICLCRDGY
QKVGDECIAINVSVCNQSSKNNISLCSFNQQCFDTKSSYECRCLTGYEKTESGQCQDINE
CEGNVLACQPNADCINTNGSYYCKCKEGFVGTNVSNTTMMLCYTTSVWSSWEQIGVCSER
CSTNKNQGRLKFQRFCEAIDFSNCNGDFFKQEMCNSEFCDNKIEILKSIDCQKWPYMQAN
LISQTVLNNETWLKKLRTWGGWKAKTCGQLLTDASKIVNQDIEIIVKEIKLLLDDRNTLQ
KVIDCNTSNQQKNSLQRQYIAIYSRLTMYRAIKATLSKLKSRIDVKLNECTRQLIEEGEN
DSSSKFFFIAKTLTKCRKIVTSFNHSSQLNDLLEESQIQQGVERNHILHLIQDVKTRWHS
TFLMAERMLKLHSYVKDIFNSKQQYKDMRKNLLDEDEIVNLKETVKALVSFNQ
Download sequence
Identical sequences gi|449688514|ref|XP_002155794.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]