SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449689568|ref|XP_002167361.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449689568|ref|XP_002167361.2|
Domain Number 1 Region: 17-179
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.24e-27
Family Laminin G-like module 0.0037
Further Details:      
 
Domain Number 2 Region: 210-389
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.62e-20
Family Laminin G-like module 0.0066
Further Details:      
 
Domain Number 3 Region: 382-419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000101
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  gi|449689568|ref|XP_002167361.2|
Domain Number - Region: 414-477
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000356
Family Fibrinogen C-terminal domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449689568|ref|XP_002167361.2|
Sequence length 827
Comment PREDICTED: contactin-associated protein-like 4-like [Hydra magnipapillata]
Sequence
MKLCVLNTSLLLCVEAFSVIFAITISLKGKERIEYNLGYERMQTDSINLIFKFRTIDPSG
LIFYGTNLLRGDFICLELINGELRYTSKIGFDDKSDQKLVVGNNLNTYEWHRVNLTRVGR
NVSIILDNVKNERYFDGDFEKIILGGRVYFGGVSEQVDLSLHQLTTRKFSGCLQNLMFNN
IDIFYNAKYSEEKFQTFGDILWDRCEDIDYDPVMFQSQQDHALIPTFIKDSLNVVLNFRT
AIKNGLIFFKPSKALCVYLALKDGVLTLEVDFAKRNENPILIKLGKDFNDGFWHRVEFLI
TSKKVMLQIEKFYEEVDLKKGYSHYPVQFDINNSSLAGGNEEKLGGFVGCIYNIWVDNTL
IDFSKLGDEYTFGVIKKCELKDHCLFTPCQHGGICSQDFHTYKCDCSFIHYYGDKCQHSI
FQQGCQAYKDLGVKEDSYCMIDPDGDKGAVKPFKVLCNMTSDSKLAFTILSHKKENNDIP
IYMGEREGNTLKTVFDYGLSIEAIEVMFRSASACQQFIQLKCRNTRLLNSPSGPAVVHWE
GREGLKEDYWGGAPPDSSMCACGVNQTCADGLKFCNCDISDDIWREDSGFINEIDRLPIM
AIYANISANNSYLSVGALKCHFTNNVNELGSFKERSLAACLSVNAKPTELPTLKITTANF
NGKQVEGWLKTIESTSATLENSIIQKVNFNLTLAIPSNDADKDGLKLQLGKWAILSIAIM
VVLVAIIIGVVCIVKRWQRSSNRTEFDDDDEYQVSNQERTEMCTFFGAVARNERNRPVIE
VHRHSIHFDTFDELPPAYREYGDRSLQQPITTHIDLSYKSRKSGFFC
Download sequence
Identical sequences gi|449689568|ref|XP_002167361.2| XP_002167361.2.79663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]