SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449689576|ref|XP_002166739.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449689576|ref|XP_002166739.2|
Domain Number 1 Region: 196-235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000162
Family EGF-type module 0.026
Further Details:      
 
Domain Number 2 Region: 292-332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000209
Family EGF-type module 0.027
Further Details:      
 
Domain Number 3 Region: 147-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000215
Family EGF-type module 0.025
Further Details:      
 
Domain Number 4 Region: 49-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000468
Family EGF-type module 0.026
Further Details:      
 
Domain Number 5 Region: 1-39
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000008
Family EGF-type module 0.028
Further Details:      
 
Domain Number 6 Region: 245-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000976
Family EGF-type module 0.022
Further Details:      
 
Domain Number 7 Region: 97-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000144
Family EGF-type module 0.028
Further Details:      
 
Weak hits

Sequence:  gi|449689576|ref|XP_002166739.2|
Domain Number - Region: 956-981
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0837
Family EGF-type module 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449689576|ref|XP_002166739.2|
Sequence length 983
Comment PREDICTED: von Willebrand factor D and EGF domain-containing protein-like, partial [Hydra magnipapillata]
Sequence
INECASNTTNNCSVNAICKNFIGGFECTCKNGFNTINGGIETLWDQCGDINECASETTNN
CSVNAVCNNYIGWYNCTCKNGFKSSSGGIETPSDQCQDINECASETTNNCSVNAICNNFI
GGYNCTCNNGFNTSNGVLETIADLCRDINECASETTNNCSVNAICNNFIGGYNCTCKNGF
NTSNGVLETIADLCRDINKCSSQTSNNCSVNAICKNFIGGYNCTCKNGFSTSNGGIETLS
DQCADINECASEATNNCSVNSICNNFIGRYNCTCKNGFNTSNGIGIETISDLCEDINECA
SETTNNCSVNAMCNNYIGGYNCRCKTGFITSNGRIETLSDQCREKIPEVEKDPVVTVGVK
DKRLRFICKFHTVKESNVRYEVTWFQGPVEKQIKGPDTFTSDQNEAFLQNTNKYGKNGTF
CMGYNIYCKVQSYYIENKGIKSQPRKSNEFFAGLQVNPMLLVLSEKDSPSNITIKSTVPI
VCGDGTENCRVLVEMGQTTADHFVDYCTLQFKPGPAGQTKEVEVVAKRDFVDDGNQRMFL
KMFIPDHIDPMDWNCHKRIADVEIKTVDVKTARCTSSGDPHFTTFDQFYYSHYYVGDYVL
VQSTARNFKVHARTFACSQSVSCNCGVAAQEGDDVIVIDMCRDNIPRARFASTVEPQSGT
SLTRDNNGKTFLISFPSGAFIKFTTQYWRNHFANIEIQLPPDDFKKTQGLCGTFDNDQCN
DMMAKDGKIYSIGRGWFAKQEFSESFFYLKDLMSLNDVFVFFGVDWVLLKRICFTSEEGQ
ENVQQQERKHIVFVVNIVVGLKEKSIVILKGAKHCGRRKRRSLDNNVIVLPDDGNTEIYD
YNPVQVSGNITSFPTASGITENQAIEVCKNRIRNSMAGKACLDVIGPSFLTDSYEQQCVI
DIQVTDSEKMGVESAINSLISACEELTLRNLSFWRSADGNITSPPSKIAENLCPNECNGN
GKCKNGTCICNPTFITSDCSMKE
Download sequence
Identical sequences gi|449689576|ref|XP_002166739.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]