SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Walse1|9879|gw1.1.538.1 from Wallemia sebi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Walse1|9879|gw1.1.538.1
Domain Number 1 Region: 18-56
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000445
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Walse1|9879|gw1.1.538.1
Sequence length 102
Sequence
LSDLLQLQKKPEISTPYDPVHLTHVGFNSDTGEFTGLPKEWQQLLQDSGISKQDQEANPQ
AVMDIVAFYQDAQKAQLGAEDSQVWKKMGGVANGQPTGPVEK
Download sequence
Identical sequences I4YJA0
jgi|Walse1|9879|gw1.1.538.1 XP_006955640.1.58810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]