SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Wolco1|63654|e_gw1.1.3813.1 from Wolfiporia cocos MD-104 SS10 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Wolco1|63654|e_gw1.1.3813.1
Domain Number 1 Region: 391-596
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.15e-36
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.000022
Further Details:      
 
Domain Number 2 Region: 121-248
Classification Level Classification E-value
Superfamily WGR domain-like 3.14e-26
Family WGR domain 0.0011
Further Details:      
 
Domain Number 3 Region: 306-360
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 0.0000000000000314
Family Domain of poly(ADP-ribose) polymerase 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Wolco1|63654|e_gw1.1.3813.1
Sequence length 597
Sequence
MPPRKKAATADASDAPAPVPTRSSTRTRAPSARATAVAAAASIATKPAAKEKADSKANFA
STKGKGKGKRVRDASDDEAEAAPDAKRGKAGDEADATNDINDEADSKKPQADAKSDDMAG
KFVTVLKRGTAPVDPCSGRVDTHQVLETPEGVWDATLNQTNVLQNANKFYVIQLLHPIGN
PGSSLLFTRWGRVGEIGQQQQKVTHKHGPFPIATAINEFRKQFKNKAGVDWNQRHGMVAK
KGKYQWIERVFEDEKEDAEDSTKAGPSKKEEAEKIADSTLGPEIQASALRSIISQPTGDT
ATQLGGFRQAVLELTGRYYSIIPHAFGRSRPIVIDTAIHLKRELELVDALSDMEIASKLI
ASTAQTLQRDASGQLLNPLDANFLSLGLSFMEPIVRSSKEFAALQTYARDTHGATHGHYQ
VNVKHAYRVERQSETDAWMKSGHDKAVDGERLLLWHGSRTTNFAGILSQGLRIAPPEGYM
FGKGVYFADSAGYCHSYLSNHTGLLLLCEVVAKPFFEQRDSNYNADEDCKKAQKKATKGL
GRTQPAEWQDAGEALDNEALKGCHMPKGPAKDVDTPLGLYLQYNEIRVRYLLMVDMK
Download sequence
Identical sequences A0A2H3IUC3
jgi|Wolco1|63654|e_gw1.1.3813.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]