SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193580252|ref|XP_001947614.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193580252|ref|XP_001947614.1|
Domain Number 1 Region: 465-989
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.18e-115
Family alpha-mannosidase, C-terminal domain 0.0000213
Further Details:      
 
Domain Number 2 Region: 1-325
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.27e-93
Family alpha-mannosidase 0.000000133
Further Details:      
 
Domain Number 3 Region: 333-443
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 6.87e-29
Family alpha-mannosidase, domain 2 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|193580252|ref|XP_001947614.1|
Sequence length 991
Comment PREDICTED: similar to mannosidase alpha class 2a, partial [Acyrthosiphon pisum]
Sequence
IIVVPHSHNDPGWLRTFEGYYHLQTSKVLNYMVEKMTVLKNMTFVWSEISFLALWWESAH
PTKKKVVQRLLAEGRLEITTGGWVMTDEATTHIYAMLDQLIEGHQWVKNNLGVNIKTGWS
VDPFGHGPTVPYLLKKSEVTGGTVIQRLHYAWKEWFARTQNGDFMWRQNWDRTGHTDTLV
HNMPFSIYSIRSSCGPHPQVCINYDFRKVPGEFTDYSELAVFIDDQNVKQKADVLMDQYG
RTASVSPYNVALIPLGDDFRYDHDTEWDQQYTNYMKLFDFINANKERYHGAEVGFGTPSD
FFRALRARSDGQFPTLRGDFFVYSDVFSEGRPAYWSGYYTTRPYWKVLDRELESKLRSTE
ILYTFAVNDARRKKLQTVRLLERNYEKLTKARQNLALFQHHDAITGTSKAFVMNDYALKL
FEGIQNCASIQSFAVQCLLSKAGDSGAPLSAKIVVPDSDRQTYDQPTYRLALNIDKSRPR
NVIVFNPLARRKTEPIKVLVSEPNVRVVDSDGSVVRHQINPVWNLSDTAEQPLTMSKVCF
ELVFVAVLEPLSLTTFTIQKAPNPEGLALVYCKNCAGHSVFTVNPMRLGDVQLENDHIQV
LFDGKTGLLSSIVDKSTGVSQYVNIDFAAYQAAQLHSGAYLFMPDPNLRDTEKKVLDDYP
GPSTVIITSGPISSEITVVYGIVTHRVRLYHGKGVESKGLYVENVVDFKQPPKNRETELF
MRLSSGIANGEPAVIYTDSNGFQMQKRVTVKRVGIEGNYYPTTTTAYIEDDRHRLTVLVN
HAQGAAGWEPGRIELMLDRRTLYDDSRGMGEGVVDNKPTLTKYWILLETVSDDGSGSKGG
DRVSNPSLVANQLSESLLYPADVFVVEPDAEHHLHPGLAMIDRPVPCDVHLMNFRTNTDP
VFQQFPSPSALMVLHRKGYDCRVDKGYRIPDCQLRRDRGVFDPGTGFAGLDRLQIARTTV
TGMHPMDAVDRLDQVEVASMELAVFNVTFVD
Download sequence
Identical sequences gi|193580252|ref|XP_001947614.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]