SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193584783|ref|XP_001945418.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193584783|ref|XP_001945418.1|
Domain Number 1 Region: 166-475
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4.7e-39
Family NodB-like polysaccharide deacetylase 0.015
Further Details:      
 
Domain Number 2 Region: 61-105
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000256
Family Tachycitin 0.015
Further Details:      
 
Domain Number 3 Region: 121-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|193584783|ref|XP_001945418.1|
Sequence length 541
Comment PREDICTED: similar to chitin deacetylase 1 [Acyrthosiphon pisum]
Sequence
MSISLRLLAIACLITLGSCDSLLSRIKRQQASTSEPKKEESFEIEICKDKDAGEWFRLTA
QDGDSCRDVIQCTSSGLQAIRCPAGLYFDIEKQTCDWKAAVKNCKLKNKERKVKPLLFTD
EPLCQDGELSCGDKSCIERGLFCNGEKNCPDGSDENSCDNDNDPNRAPPCDPAVCVLPDC
FCSEDGTGIPNDLPAKEVPQMITITFDDAINNNNIELYKEIFNGKRRNPNGCDIKATFFV
SHKYTNYSAVQETHRKGHEIAVHSITHNDDEQFWSNATVEDWAKEMAGMRIITEKYANLT
DNSVVGLRSPYLRVGGNNQFTMMEEQAFLYDSSITAPLSNPPLWPYTMYFRMPHRCHGNL
QHCPTRSHAVWEMVMNELDRREDPSFDEYLPGCAMVDSCSNILSGDQFYNFLNHNFDRHY
DQNRAPMGLYFHAAWLKNNPEYLDAFLFWIDEVLANHNDVYFVTMTQVIQWIQKPRIINE
VKNFEPWREKCVVEGPQACLVPHSCKLTSKEVPGETINLQTCVRCPNNYPWLNDPTGDGF
F
Download sequence
Identical sequences gi|193584783|ref|XP_001945418.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]