SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193591720|ref|XP_001943647.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193591720|ref|XP_001943647.1|
Domain Number 1 Region: 347-445
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.91e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0033
Further Details:      
 
Domain Number 2 Region: 64-135
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.22e-16
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 
Domain Number 3 Region: 151-205,233-279
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000265
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|193591720|ref|XP_001943647.1|
Sequence length 648
Comment PREDICTED: similar to CYCLE [Acyrthosiphon pisum]
Sequence
MKPRKRHYSRSSYNIQNSTRLASSTADLSMDLSGDEHYKNKRKASTHGSDFDDDNNDDSR
SVRNDNNKKHNHSEIEKRRRDKMNSYITELASMIPMCHTMPRKLDKLSVLRMAVQHMKTI
RSNVNSYTEGHYKPSFLSDQDLKTLITHAAEGFVLAVSCDHGKILYTSKSVTQVLNYMPE
DLVGNNVFDYIHPKDVAKVKEQLSCSDFGPRDKYINANTMLPARAEMMNTLSKMCSGARR
SFFCRMKCKVYDIKEEADTTTGSKYTQSDRRYNVIQCTGYLKPWTQINECEDVSGKSLGL
DEDNDGNGVGGDSGSPKNTSCLVAVGRIINNLASSSLLSDIVKPPCFTSKHTIDGKFLSV
DQRVTYIVGFLPQELLGTSMYEYFHQDDIARLVNIHKATLQECKPKDTEIYKFRAKNKTF
VNLRSSWKSFRNPWTKDIEFIVANNILTRTDFKPDSSNKSECSSQGQSQNNHDSFTDQQL
SKSQQQLGNREIQNLITSHIEANKIGRHIVDTTLDVKKAMCDTDSSPPNSLKDTIEKESK
NDSLQFLSSPLAMLNEPGTLSSSGGDGGSGNTDSSYTAIQDSVNLLNSTNTNNDSETMLG
EIMTSSPQQLSNLGTNDEAAMAVIMSLLEADAGLGGPVDFSGLPWPLP
Download sequence
Identical sequences J9JWC5
XP_016663169.1.67334 gi|193591720|ref|XP_001943647.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]