SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193591977|ref|XP_001947975.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193591977|ref|XP_001947975.1|
Domain Number 1 Region: 677-858
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.94e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0061
Further Details:      
 
Domain Number 2 Region: 833-944
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.28e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0047
Further Details:      
 
Domain Number 3 Region: 142-170,246-353
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000369
Family Phosphotyrosine-binding domain (PTB) 0.039
Further Details:      
 
Domain Number 4 Region: 2-114
Classification Level Classification E-value
Superfamily PH domain-like 0.0000184
Family Phosphotyrosine-binding domain (PTB) 0.016
Further Details:      
 
Weak hits

Sequence:  gi|193591977|ref|XP_001947975.1|
Domain Number - Region: 365-393
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0288
Family PHD domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|193591977|ref|XP_001947975.1|
Sequence length 1218
Comment PREDICTED: similar to rab6 GTPase activating protein [Acyrthosiphon pisum]
Sequence
MKLYKVEYLSSCTVNKRLTNPMIPWIIAEIKKNNYHKKVKIGIKDASLVIYENWDCKNKL
FFQHELKYITRLAFLNSDVVTFFYAVRDMADENNVHCHVYNTTQPDEVMELFSTMKENSH
KSLQSIGRSLSNAQTLTSLCADISPNSSHFFEVLYVGKIRVSQKRVPNSFIDDALEKFRL
HELEKSKKSNSTNTSRRGSQINSSDQNTTYLSDPRRGSMIVLSPGIENQGSSFGVEKQTK
ELEITRTRSGSINYPIKNLDTNGQNTNIAEEINRTMVFQIGRTDLRLISPDRKQILLHKQ
LKDIINCVQGSRNQLHFGFTCRDSSSSESCIGYIFKCESESVAIELVTAINLAINNTNEA
LKKEKQVIVSCEHCPMVWFHKLCSDIENLNEHKIQTVIFKQLETLPEDDQEIVLTKLHGL
ETLSKISLKEQNELLIMLLRTHCESKQMRHVHDSAENRHEFLNQYLGGSTIFMKAKRSLT
SSFDQLMKRRSSKDDVGLIASVKENSLPNNIAFNKEPSPKSDLSSRLIVQPSISNSKAHP
NKSEVYLAETKSHSSPASMMNMFLKVGQSPKSSMISTSDNDSDEQNDLNPGSWRQAIFKN
VVTPNKQTKDTENVKKKLDADDLRALWKKAINQQVLLIRMEKENAKLKERQEEATVKRIK
LEYDDIGSSAREYLGVWETIVNKENRKFDAKMLRQAIRQGVPRSKRGDVWIFFAELYCNT
TAPSPIDLEKFPNFNVPYEQLLKQLTKYQHAILIDLGRTFPNHTYFMSPFGPGQLALYNL
LKAYSLLDPEVGYCQGLCFVAGVLLLHMSEEQAFMMLKHLMFRRSLRKQYLPDMAALQVQ
LYQLSRLLHDHHPDLYAHFDNCDIPPTLYAAPWFLTMFASQFPLGFVARIFDILFFENID
VLFRIILSLLTYHKDNLLACDGMEQIMNFIKNDLPVVNNEIIDKIIKQVFTTDLSKQLME
YGVEYHVLQEELSSPNPEIKKIKNLEETNKALMQQNKILHEQLEISITNNGRLEMNRSSN
LSAINRLESEVKSLELTVATLGNFVSELAYAHSDIEIPPDVLGLISQINMCRNRRNDNKQ
TNINNLFSKPQLEIPYRIKPMLEKSLSDSKNILKKSIKEEINQEEVKKKNCLKSSKSNYE
LFSNESNLNNNGLHPLDCEDVSVCYSGTTKLRTIKPIRSNSDGHFILPNIVAIDVDDSLC
KRDKNENIELNTSTVNGN
Download sequence
Identical sequences J9JTC8
XP_001947975.1.67334 gi|193591977|ref|XP_001947975.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]