SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193595384|ref|XP_001945040.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193595384|ref|XP_001945040.1|
Domain Number 1 Region: 365-464
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.93e-28
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00098
Further Details:      
 
Domain Number 2 Region: 170-224,251-266
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.24e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 
Domain Number 3 Region: 88-171
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000379
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|193595384|ref|XP_001945040.1|
Sequence length 695
Comment PREDICTED: similar to arylhydrocarbon receptor nuclear translocator homolog b [Acyrthosiphon pisum]
Sequence
MYGYAGPPHYGAIESSAGDPGGYLQPGPIPMAMVMPMPAVCEPPPPPPLQIPDEAIQKRR
RSDEEDSSQKYSRMEDDNIQDKERFASRENHCEIERRRRNKMTAYITELSDMVPACQSLA
RKPDKLTILRMAVNHMKSLRGTGNTNNDGTYKPSFLTDQELKHLILEAADGFLFVVTCDT
GRVIYVSDSVAPVLNYSQNDWLGTSMFDHLHPEDVEKVREQLSTQEPQNSGRILDLKTGT
VKKEGHQSSMRLCMGSRRGFICRMKIGNSGGMMSSISGHNLHQRLKQRNTLGPTRDGNEF
AVIHCTGYIKNWPPSGQFDHPLSGVQIERAVEEDGTHCCLVAIGRLQVTSTPNTTDLAGS
NSNAEFISRHSMDGKFTFVDQRVTHILGYKPQDLLSKTCYEFFHPEDQTHMKESFEQVLK
MKGQMMSVMYRFRGKNHDWIWLRTNAFAFLNPYTDDIEYIVCNNSTAKSSMHSPSESGVN
ISNPSTEPVYQQQAPGLDYTVQRRDHVAAPPYQAHAMIAAAPTASQHMIPNNTAQRPNSA
QNVFNTYETNASPISYHSPNQGTQSQVQSPLINRLTKSSPTPAQTAWTLRQPVTEGYQYN
QEMSPSRSPSGPTYTQLSGGARQTTYHNPSPATASPGMWGWQAGATGATAVANNVPPHPH
SGHPQELSDMMMQMLDQSAAAASFEDLNMFNTNFE
Download sequence
Identical sequences XP_008180099.1.67334 gi|193595384|ref|XP_001945040.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]