SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193596476|ref|XP_001949722.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193596476|ref|XP_001949722.1|
Domain Number 1 Region: 173-414
Classification Level Classification E-value
Superfamily vWA-like 1.21e-77
Family Integrin A (or I) domain 0.000000646
Further Details:      
 
Domain Number 2 Region: 416-503
Classification Level Classification E-value
Superfamily Integrin domains 2.2e-19
Family Integrin domains 0.00091
Further Details:      
 
Domain Number 3 Region: 684-767
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.31e-17
Family Integrin beta tail domain 0.0012
Further Details:      
 
Domain Number 4 Region: 47-98
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000152
Family Plexin repeat 0.0046
Further Details:      
 
Domain Number 5 Region: 596-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000134
Family Integrin beta EGF-like domains 0.0089
Further Details:      
 
Weak hits

Sequence:  gi|193596476|ref|XP_001949722.1|
Domain Number - Region: 643-683
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000156
Family Integrin beta EGF-like domains 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|193596476|ref|XP_001949722.1|
Sequence length 841
Comment PREDICTED: similar to integrin beta subunit (AGAP000815-PA) [Acyrthosiphon pisum]
Sequence
MNTPLYRGGIIIQTKMNKLLMMMILTVSLLTLGFCYADKIQQQLIRLNPCVLKQTCHECI
QTPTCAWCAQPKFDGERCFQSTINSNMIQCNEHYINNPKNEYKVLNSRELQKARKNTNSH
MSSDSSSGGSSSSASKGSAASSTHDAVQISPQQVSLKLRINEAHRITVNYAQAEDYPVDL
YYLMDLSHSMEDDKQKLSALGNLLAESMQNITSNFRLGFGSFVDKVVMPYVNTMPKNISP
CPRCDAPPYGFQNIMSLSQDTNTFASEVQRAPVSGNLDAPEGGFDAIMQAIVCRDQIGWR
ERARRLLLFSTDAGFHYAGDGKLGGIINPNDGRCHLDNRGSYTHSSLQDYPSVSQINLKV
RQNSINMIFAVTREQRNVYERLIQLIEGASIGTLSENSEHIVDLVKDQYSKISSSVEMRD
TASSAIKVTYHSSCLDKDGVLKQTNKCDGLKVGTVVNFQAEIEVTSCPPNRKDWTQKFQI
YPVGINESLTVSLYMQCECQCENVGHPDYLKKSPDCRGVGTLKCGVCECDSTHFGRMCEC
DANNNHHGNYTYMVSGCQLNNDSEINCSDRGECNCGQCDCQVRSNPEERVYGTYCECDNF
SCDRSGGALCGGYGTCDCGVCKCIPGWTGESCDCHATNETCIMDGSNEICSGRGNCECGQ
CKCSEENDIRYSGKYCQKCPTCPGRCQEFKECIQCLVYKTGSMSPEECEKSCTIKPIIVK
VAEANEDKDENMCSYYDQDNCRFAYVYTYDQSGKIVIRAQEERECPPQVNFMGVILGVIG
AIVLIGMALLLLWKLLTTIDDRREFAKFEKQSMIAKWATSENPIYRQATTTFKNPTSMGN
S
Download sequence
Identical sequences gi|193596476|ref|XP_001949722.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]