SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193622526|ref|XP_001945720.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193622526|ref|XP_001945720.1|
Domain Number 1 Region: 245-539
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.94e-87
Family Complement components 0.0000287
Further Details:      
 
Domain Number 2 Region: 616-749
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 4.71e-35
Family Alpha-macroglobulin receptor domain 0.00087
Further Details:      
 
Domain Number 3 Region: 78-130
Classification Level Classification E-value
Superfamily E set domains 0.0000136
Family SVA-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|193622526|ref|XP_001945720.1|
Sequence length 811
Comment PREDICTED: similar to Thiolester containing protein II CG7052-PD [Acyrthosiphon pisum]
Sequence
MDDQEMMPIPSTVSETSSSIKVRKNFPETWLWESTESGQDGRASMKSTVPDTITSWVITA
FSVDSLYGLGLLDSPKKLKVFRPFFISVDLPYSVRRGEYVSIPVVVFNYLSKDVTADVTL
ENIGQFDFADTSNDVRDSKLELYKRKSLTIKSNSGSPTSFLIQTKDLGYISIKLTATSKL
AGDAIEKKLLVKPEGETIYKNKAIFVDLRKESLFEKNITLEIPSNIVPDSEFIEIGAVGD
ILGPSTMNLASLIQMPFGCGEQNMLNFVPNIVILDYLKNTKQLTTAVETKSLKYMETGYQ
QELTYRRSDGSFSAFGSADASGSTWLTAYVVKSFRQAMPYIPIEEKIIIEGLQWLSNNQA
NNGSFPEVGYVSHSDIQGGSSKGLALTAYTLIAFLENQKATPVYRNTINRAVEYLVRNLP
GVEDPYAIAICSYALHLADHPEKNVAFNLLELKANTVDGKKWWKRMDRANDKKNPWVHEP
NSVDVEMTAYALLTYLQRELVEDGLPILHWLVSQQNDQGGFASSQDTVITLYALSQMAER
ITPGTLKLSATFSYMKNGQSELKVTKDNAMVLQLIELPKRTRILNVTATGTGLAIIKVSY
RYNVNVTGAWPLFSLDPQVDKNSNANHLQLSVCSGYIFRGGNDSNMAVMEVTLPSGFTVD
NDALPSLRLSNNIKRVETKDGDTVVMLYFDKMMAEEYCPTISAFQTHKVANQKPVPVTVY
DYYDQSRRARVFYAPRKATPCEICEDSDCTKMCVQTDNPKSGAPLQLHNEPIADDFEEDN
HKNPEALINTACGWRMNGQCQFRSFKKHLSL
Download sequence
Identical sequences gi|193622526|ref|XP_001945720.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]