SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193624902|ref|XP_001946943.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193624902|ref|XP_001946943.1|
Domain Number 1 Region: 32-376
Classification Level Classification E-value
Superfamily L domain-like 1.14e-53
Family Ngr ectodomain-like 0.024
Further Details:      
 
Domain Number 2 Region: 313-631
Classification Level Classification E-value
Superfamily L domain-like 5.92e-47
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 3 Region: 729-898
Classification Level Classification E-value
Superfamily L domain-like 1.09e-29
Family Ngr ectodomain-like 0.0091
Further Details:      
 
Domain Number 4 Region: 977-1128
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.09e-26
Family Toll/Interleukin receptor TIR domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|193624902|ref|XP_001946943.1|
Sequence length 1282
Comment PREDICTED: similar to 18 wheeler [Acyrthosiphon pisum]
Sequence
MDSPNFSSVQPEGTVRLTVDCTDKLFLQSTLAPRMFRSLHQLEELVLIRCKLLDIPADAF
DGLGGLKKLTVHTSNLEWGATKTMELAQGSLDRLTELQSLDLSESNVHTVPADAFCALKN
IQQLNVSHNGIEDLTTLGFSGPDCPGGTDLKVLNLSWNNLQSVPARTAISAMKRLQTLGL
QHNSITEIAADSLSTLASLKVFNASYNKLEALPETLFAKNRELREVYLQNNGLYELPRGL
FHRLEQMVIINLSNNKINQIDEGPFVGLLRLVVLDLSRNGLTRIKSNVFKDLVFLQILDL
SNNSISSIEENAFLPLYNLHTLNLAENRLHTIGSRLFNGLYVLSKLTINNNLLITIDDQA
FKNCSALKELDLSSNAIQQVPAALNELSFLKTLDLGENQISVFHNNSFKNMELLTGLRLV
DNFIGNLTQGMFSNLPNLQVLNLSKNKIYTIERGTFTQNSQIQAIRLDANYLTDVNGVFE
SLSSLQWINLSKNNLIWFDYAMVPANLKWLDLHDNYVQELGDYYNLKDRLNINTIDASHN
HITEISERSIPNSVEVLFLNNNFLSNIRPNTFLKKRNLVRVDLYANELTRLDVNALRLGV
VPINRSLPEFYIGGNPFECDCSMDWLPAVNNMTQLRQNPKVMDLDNVVCKTTDSRGSEVV
PILSAGPSQFLCKYETHCFTVCKCCEYDACDCEMTCPSNCTCYHDQTWHTNIVDCSYQLN
NQVPPKLPMDATHVYLDGNNFNQLQGHIFIGRKNMVHLYLNNSKIESLQNHTFNRLSSLQ
VLHLEDNMLTELKGYEFEQLYQLRQLHLHNNRLSYVNNMTFAPLRNLEVLKLHGNLLSNF
NVWQLSVNPYLVQLSVGKNPWSCRCKFLQPFRNWVYENGPKISDMTDVTCVPDESDPGQR
REIDFNETTCSDFYTGGWALRNMMTSSYVPLLTFLLVVFVVALVLFAVRDNIKVWLYTKY
GIRVFSCKNSGNKHFYEDREKLYDGYVLYSPKDEEFVLQSVVAELEHGNPSYQLCLHYRD
LPITSMYHAGSSPVVIEAAEASRRVIVVLSRNFIQTEWSRYEFRSALHEALKGKVYKLVL
IEENSIAAEADADPEIRPYLKTASKVRWGEKRFWERLRYLMPSNNHHNNNHHHHKVCNYR
NNINNYTIDTRTPVVPAHRRQPPPSPQDKAPHHRPHGHHHHHHQHHQQQQHSPGSLPRPQ
HRHEDSNYSTATTATPSPKLGGGCEDRPASTEHIYSAIDTPPPSVHQSPSRMMPPTHQFE
RTNSRRSAKHHQHQNAVQAYLV
Download sequence
Identical sequences gi|193624902|ref|XP_001946943.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]