SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193629562|ref|XP_001950069.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193629562|ref|XP_001950069.1|
Domain Number 1 Region: 1138-1334
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.13e-26
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 2 Region: 1354-1516
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-18
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 3 Region: 732-864
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000502
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 386-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000467
Family EGF-type module 0.004
Further Details:      
 
Domain Number 5 Region: 860-903
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000475
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 6 Region: 626-669
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000168
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 348-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000268
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 8 Region: 309-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000475
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 9 Region: 535-671
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000549
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number 10 Region: 937-980
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000896
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 11 Region: 1869-1906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000921
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 12 Region: 1831-1869
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000015
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 13 Region: 898-942
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000219
Family EGF-type module 0.0026
Further Details:      
 
Domain Number 14 Region: 269-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000536
Family EGF-type module 0.013
Further Details:      
 
Domain Number 15 Region: 1033-1080
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000126
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 16 Region: 1607-1642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000185
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 17 Region: 673-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000196
Family EGF-type module 0.012
Further Details:      
 
Domain Number 18 Region: 187-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000267
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 19 Region: 512-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000042
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 20 Region: 25-155
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000619
Family Laminin G-like module 0.038
Further Details:      
 
Domain Number 21 Region: 464-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000256
Family EGF-type module 0.025
Further Details:      
 
Domain Number 22 Region: 1950-1994
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000595
Family EGF-type module 0.014
Further Details:      
 
Domain Number 23 Region: 232-266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000196
Family EGF-type module 0.017
Further Details:      
 
Domain Number 24 Region: 1796-1835
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000554
Family EGF-type module 0.01
Further Details:      
 
Domain Number 25 Region: 1076-1114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family EGF-type module 0.017
Further Details:      
 
Domain Number 26 Region: 1994-2028
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000193
Family EGF-type module 0.015
Further Details:      
 
Domain Number 27 Region: 2028-2066
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000209
Family EGF-type module 0.014
Further Details:      
 
Domain Number 28 Region: 2068-2111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000342
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 29 Region: 424-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000589
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  gi|193629562|ref|XP_001950069.1|
Domain Number - Region: 1910-1951
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 975-994
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00949
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|193629562|ref|XP_001950069.1|
Sequence length 2181
Comment PREDICTED: similar to AGAP003873-PA [Acyrthosiphon pisum]
Sequence
MIESKQRMLPLDFGWRSGGADREGYFNSSSWLNLFPPISLYKHIGFSFRTCSGGQIFSQT
QDLPYNQISVDVLHDGLLFTTFLQNKHFESKIQGDFFDNSWHNVNFIYKLGELTISVDSL
QQVIANSTFNSEILNSEITTDQSMLRVGDGFEGCLLEGPNFIFNSSLNQAYKVVWGHCPL
NSQSCTGIDYCSHAPCMMHGVCVPRQNKYHCICQPRYSGNNCEIDNGSPCAKQNNRCMHG
LCEEINYGNDFMCHCDQGFTGKFCEIELSAHVCDNNPCRNNGTCKLTSGGKSYECSCAPG
FKGDDCEININECLSSPCQHGGVCIDGVNNYTCACSKTGYKGINCETNINECEINPCSNQ
GICFDNYGSYTCQCQSGFGGINCDIELNECVSNPCQNGGQCRDQVGTYECRCALGFIGRN
CEINVDDCESAVCPTNSICVDGVASHSCHCKSGYTGVPPNCSEITVCSSHPCQNGGSCGL
LPNGQFNCSCSLGYTGAFCEHGNIVARSHADDVCVIMPCLNSGTCISQGSNYECKCPAGF
TGRNCEMTMKCNATPCQHFVSCRDYAGGYYCECEPGWSGQQCNQRDPACSPNTCAHGGTC
TLLAGQADPFHCDCPPGFTGQTCQIDIDECMSKPCLNGGICHDLINGFRCNCTDNYMGAY
CQLPFDACTKNPSPCLNNGTCLHKTSSLKDYYCKCSPGFEGKNCEGNIDECKTGTCPVGK
VCIDGINTYECECPEGYTGENCSKILNDCRDNLCKNNSTCIEDVDGYTCRCMSGFTGMHC
DQDINECEVNKEVCNYGICVNTNGSYQCFCRPGFSGDNCDVDFDECLSQPCYHGATCENK
INGFNCICPPGYTGKVCSIDINECSSNPCLNGATCIDNIASFTCSCPPGIVGKLCETNID
DCESSPCQNMGLCIDGLNSYECNCTNTGFEGNHCELNINDCIHDQCENNGTCIDGIKDYS
CKCYTGYTGKNCEVDINDCENNPCQYGGTCLEHSNISLYNQKDNNNLSAIFQQEFSYATA
XXFECLCLPGTTGIKCEIDINECDSNPCNYGACENKINGFICACEDGYEGRYCETEINEC
ERFKPCDHGTCMDRRAGYYCDCAPKYGGKNCSVELFGCQDHHCLNNGTCKPYLIDEIEHR
YNCSCPYGFHGHICDKTTTMSLTGESRIVVNTTRDEGYDISFRFKTTLPSGLLAIGGGST
FYILELVKGRLNLHSSLLNKWEGVFIGSELNNSQWQKVFVAINSSHLVLSANEEQTIYPI
NLNEGANPTHTSFPTTYVGGTISNLRLLPHGPPYFTGCIENLLINGQWVLPDDKVGSTIG
LTNVDIGCQRNDQCFPNPCHNSGHCTDLWKTFSCTCERPYLGNTCQYSFPAATFGHENIT
TGLVTVNVFAVAKRAVRNIVDISMFIRTRQTRGAIFYLGSMPGMVTFSEETHIAAELEGG
ELLVRIQFNATPESYTVGGVKLDDGHDHLIQVVRNITLVQVKINGTEYFRKTISATGQLD
VQVLYLGGFPSSKPSRRDLSDPLIVMDNILPRPNTIERHIRQTTADKFEGIPHFKGIIQD
VQISNGSQTMVVEFYPLGIQNKDLVVPKAFGSVSFNQDEIAQGVLSDDTCRSNPCHNDGV
CSVTWNDFTCKCPLGYKGKQCQEMEFCQLQDCPLGSECRNLNHGYECVAKITLDSRNTTE
PLLQYNFIKGQQVIPLTHIEVNYRTRTGGSIMYVSNKKNSNDSEYTFFTMIAYKDRYETS
AQRSFRFRGCLGEIRIGGLLLPYFTPTELNTNNQTDHFVMLSHNSTTQNFDLDCLLCYDY
ECKNGGRCKKATESYVCECQPGYEADDCSANINECLSNECRNSAECIDGIANYTCQCKIG
WMGTFCEIDINECESNPCHHNGICIDQLGDFECNCTDDYEGKTCEQLKLVTCDNLPCKNG
ANCFKIPDQFGNNYTCSCLEGFSGTTCDTAFCDTNECQNNGLCKKEESPFCECPLGFKGH
LCEQNIDDCFDNDNQQKCQHGGQCIDGINEFTCNCTDTGYTGDDCSIDIDECFDLNIQCG
HRGECKNTPGSFICACEKGYCGNYCDLINPCLPENPCNNGGFCQEHCTDVIVYECQCANG
YVGQNCTELPIIHNYADIALIVGPILLILLIGGMGSLLVLLMMARKKRATRGTYSPSCQE
YCNPRVELDNVLKPPPEERLI
Download sequence
Identical sequences gi|193629562|ref|XP_001950069.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]