SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193631985|ref|XP_001944363.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193631985|ref|XP_001944363.1|
Domain Number 1 Region: 176-222
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000707
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.035
Further Details:      
 
Domain Number 2 Region: 72-139
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000247
Family HLH, helix-loop-helix DNA-binding domain 0.0067
Further Details:      
 
Domain Number 3 Region: 345-450
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0001
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|193631985|ref|XP_001944363.1|
Sequence length 1450
Comment PREDICTED: similar to Nuclear receptor coactivator 2 (NCoA-2) (Transcriptional intermediary factor 2) [Acyrthosiphon pisum]
Sequence
MYPVSSGFQLMYIIYNCYKKGLRLIGFTCLFVLHEKTAKLGPYDLQESRTKMSGGASPSS
ALPKKKKKSDAKGQSQLNKCRNEKRRREQENIYIEELAELISASFADMNSLSVKPDKCAI
LQETVNQVRAGTHRLSSDQTESLISTEAAVQQGEVSSSKPTRISNTELAPLLLSALDGFL
FVVNADGQIEFVTENIQQFLHYNKEELLGKSVYNIIHHGDHTKFGVLLNNPLLIYDSPIG
SLGSNVPTTPLMEQSPSGSKGNNWNQRFTKKFNCRLLIKPPSDQDQTIEEKQTRVSQYET
LQISSTKINGGMVDDEDSTDGISQNLLCIARRVPYNEKHLSPPLEQFTIKLDQNGKILAL
DTKDVSEAYAQHINKDCLVGRLLHDKCHKNDVIKVANHLQETRRAGFGTSPVYKLHLVED
RYVKVQTKSKYFKSNENHEMDFIMAAHSIIVDSEMCAMIENNSARAAAEQMNASFNGTDP
LSLMANSVGSNQSVSILQSESKFGNDYNMTPSSDLNFSDFGLFPSTTFGDMLQENKWSEP
STNSVEPLSRTTPVPSPATVSSNPHTPVAQTQYTSFPFSPLIPSPKDSYDSCGSVDRMES
ARLRTLLMKRTDGSSEDNNVSKNKHNILKGLLNPDDMASQSADDESTNHSTPPSPANVRQ
ASRSNSNMNDSPSTPNNATTSNNNNNMLIKLLNDKSEDEDIEARAGLKKQNDLLQQLLKD
DDNVRQHGIMLEQNNQHSNEDLLLNSVGFRILSPTSPDSHNHGRKRNSISADDENDHPPL
KRTNSSGGSSGPSVLESMPSPSGSQAQVTNSKLRERNKMLASLLAKDPPPTAIPAIPASV
ISATPQDKLVTIIKHQQQQQQQQQQQQQQQQQQQSAGGWNMNSGQHSMTSSSVQTQLQSH
QRILLQKSGNNLYLNHMLDQPQALQSQNQIQLQQMRQVTSSAISGYSSLLSNIAESNSNS
LPFNSDPELSDLLEEVMDIMNVTSDNSTLLNLFNVLETPNVPNPVGQNTTNQNSYNSLMN
EKMAVNAIQKSLMQVESTVESPSPLNYGSPTGSNHHAQNQFIPPPAYQPQQKNSVRFNPQ
QSPRPPYPKNVQTPPLQQQQLLLQQQQQQKQRLIQQQQQKQRLLQQQQQQKIMVVTTNAA
TLPTPDPTTALQTIDSLLNNTGPPNVALQRSSSVPDSQSQLSPVYAAPCSVLLNSSQISP
SSNRQPPYSTLTQQSFPMLNYGTTTQTQTTTQAQQIVQQATSRMSPSSHSQYQNPINPCV
SQITGGFNNSSVRQNFLNQQQQSHGSATRVLTSPVGYNTEIPPNTNCQPQQQQQFRLPRN
INMTTTNSQIQGGNNGVTEFTRNELRAFVGVRSQQQGVTRLSNQLLPGQNVNSAELDSLG
LNFEMSPTGGNESPKWSSLNSDLSSSSPQPQGMPARNPMNDSPRTSSANSTTNVTDQKSS
SLLQKLLSEK
Download sequence
Identical sequences J9JRM8
gi|193631985|ref|XP_001944363.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]