SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193636498|ref|XP_001945055.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193636498|ref|XP_001945055.1|
Domain Number 1 Region: 71-139
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000118
Family HLH, helix-loop-helix DNA-binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 135-195
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000536
Family Hairy Orange domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|193636498|ref|XP_001945055.1|
Sequence length 331
Comment PREDICTED: similar to transcription factor HES-1 (Hairy and enhancer of split 1), putative [Acyrthosiphon pisum]
Sequence
MTGKCEPDSLPVVIPIASETSSTGIHDNNNNASSAATPSPVTATVHPFSKREPIVTSSSL
IFSQSSNQKDGKRANKPLMEKRRRARINQSLALLKTLILDSTRTENTKHSKLEKADILEL
TVRHLQRQKVLSSDVRDKYRAGFQECAREVTRFLECPELHMCSTGTGTLLSAGSTVIEPA
VKQRLLRHLDTCSSEIDLDFSNSTVVIPDDIIGGDEESNCSTIDSKNDRIKCEPPKKRAR
SKSVGVEDKVIDRGGLTASVVVAPTNDPTQPLSVVQVIPSQLPDGQVVFLLPSHYVHCQQ
NQGAEPRPPGDEPIDFSVKREHEHDSMWRPW
Download sequence
Identical sequences gi|193636498|ref|XP_001945055.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]