SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193641183|ref|XP_001948396.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193641183|ref|XP_001948396.1|
Domain Number 1 Region: 1898-2106
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.7e-53
Family Ankyrin repeat 0.0000000126
Further Details:      
 
Domain Number 2 Region: 568-698
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000235
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 416-548
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000204
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 1194-1333
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000345
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 771-814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000811
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 6 Region: 927-968
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000215
Family EGF-type module 0.0036
Further Details:      
 
Domain Number 7 Region: 221-355
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000722
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number 8 Region: 874-1006
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000188
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 9 Region: 694-742
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000149
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 10 Region: 809-848
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000411
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 11 Region: 1165-1208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000718
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 12 Region: 1004-1122
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000151
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 13 Region: 1323-1360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000732
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 14 Region: 160-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000839
Family EGF-type module 0.01
Further Details:      
 
Domain Number 15 Region: 1402-1439
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000146
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 16 Region: 732-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000373
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 17 Region: 122-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000429
Family EGF-type module 0.01
Further Details:      
 
Domain Number 18 Region: 348-388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000732
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 19 Region: 1509-1542
Classification Level Classification E-value
Superfamily Notch domain 0.000000183
Family Notch domain 0.0057
Further Details:      
 
Domain Number 20 Region: 1549-1582
Classification Level Classification E-value
Superfamily Notch domain 0.000000196
Family Notch domain 0.0028
Further Details:      
 
Domain Number 21 Region: 1364-1400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000157
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 22 Region: 1138-1175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000179
Family EGF-type module 0.017
Further Details:      
 
Domain Number 23 Region: 74-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000554
Family EGF-type module 0.015
Further Details:      
 
Domain Number 24 Region: 35-73
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000751
Family EGF-type module 0.014
Further Details:      
 
Domain Number 25 Region: 1469-1501
Classification Level Classification E-value
Superfamily Notch domain 0.0000183
Family Notch domain 0.0028
Further Details:      
 
Domain Number 26 Region: 390-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000324
Family EGF-type module 0.0085
Further Details:      
 
Weak hits

Sequence:  gi|193641183|ref|XP_001948396.1|
Domain Number - Region: 849-886
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000211
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 549-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0873
Family EGF-type module 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|193641183|ref|XP_001948396.1|
Sequence length 2475
Comment PREDICTED: similar to Notch [Acyrthosiphon pisum]
Sequence
MRRRNPGRTFVGTCILLAFWTLAAGTDGASGSTGIVSCSPNPCLHGGTCYMKRTGEYACN
CTGLFVGPYCQWKNPCHTGPVPRCQNSGTCAVTQVSPHSQPGFSCQCPLGFTASLCEIPI
SNACDSKPCQNGGTCWLHNIKEHRCNCAPGFTGPNCELEDHCASGPCKNGAECASKDDSY
ECTCAPGFTGTTCSEDIEECSTTEPCVHGQCVNTHGSYACICEPGYTGKNCEMVYVPCDP
SPCMNSGRCMQIDDLNYECKCKSGFRGKNCEENVDDCIPHACLNGGSCVDGVNSYTCSCP
AQWTGDSCEMDVDECAMRPSVCHNGATCTNSLGSYNCICVNGWTGQDCSVNIDDCAGAAC
FNGATCIDRVGSFHCQCTYGKTGLLCHLDDACTSNPCHTDAICDTSPINGSYTCSCASGY
KGVDCSEDINECEQGSPCEHDGVCVNTPGSFACNCPQGFTGPRCETNVNECDSHPCKNEG
SCLDDPGTFRCVCMPGFAGTQCEIDVDECEANPCENGGVCTDMINGYKCSCPAGFSGPRC
QTNIDDCVSSPCKHGGICHDSIAGYQCECSPGFTGFNCENNINDCLSNPCKHGECIDGQN
SFTCSCHPGYTGLLCQDQLDECASAPCQHGGTCEDLINGYQCRCRAGTSGSNCEVNINEC
VSNPCRNGAKCIDGINKYSCDCLAGFTGLHCEMNVDECASSPCANSGTCVDLVAGWRCEC
PRGYYGPRCLSDIDECASNPCSLNALRCEDGLNQFICHCRPGYTGKRCDIDIDECSSNPC
QHGGVCTDRVNGYTCQCKPGYSGHNCDVNIDDCAINPCKNGGSCIDLVNAYKCVCQLPFT
GSECQSRLDPCTPNRCRNGAKCSPSSNFLDFACECSIGWKGRLCNEDVDECALTAPCRNG
ATCQNTDGSYKCACAPGFQGRDCVINTDECASSPCQNGATCLDGIGDYTCMCSDGFSGRH
CEVDVDECLSQPCLNGATCKQYVNSYTCTCPVGFSGMHCLTNDQDCTDSSCMNGATCVDG
INNYTCICPTGYTGLNCQTRINECDSSPCENSGTCLDHGKYYTCHCAYGYTGKNCESLVD
WCSGGGGIPQPCENGATCKQIQNLYQCVCQPGWTGKVCDVEMVSCNDASLRKGVRRDALC
HNGGVCEDIGNSHRCHCADGYSGSYCTKEINECDSAPCQNGATCRDLVAGYSCQCPRGFQ
GQNCELNVDDCHPNPCQNGGTCRDLINSFSCSCPPGTLGIICDINIDDCSPEACHNNGTC
IDRVGGFDCRCPAGFVGHRCEGDINECLSNPCDPYGTLDCVQLVNNFHCNCRAGYMGRHC
ETKVNFCESSPCQNGGVCSQVEGGHTCVCPKEFSGRNCEFFGVDCDSSPCQGDGLCHSLE
HGGYQCECPPGTAGIHCEVDSYNECESNPCEHDGTCQNKLGDYACFCPIYWSGKNCNIYD
SKFKGGLGKFPSKGIMTKKDYDWERELAACITNGCTAKSQDNRCHQECNTAACDFDGGDC
SLGLNPWRNCTTTKNCWQVFADGRCDAECNTPECLYDGRDCERTLMPCNPIYDAYCQSHY
ANGHCDYGCNNAECNWDGLDCEREPPKIAEGAMRLILRMDYHQLLSNLTSFLREVGRELR
ATVRVKQDELTGKQMIFPAESPPGAVVVYLEIDNRKCEITRDVECFSSGTGAAGFLAASA
ASHALSTSFPIYKAEGVGPGSQIPIEQPRSSTALVLTGMFLILVVGLSLGVLISTHRKKA
NGITWFPEGFLRTGSNSSRTSTQRRVPDGQELRTMKQNNMTLSCMDMNSGIMTMGRGAGA
WSDEDAEGDMPPAKRHRPAPILSQPLDNPYDDVWSHCTLNSNDNKATVMYTPPSRETEVN
ERLPGGLTRLMDVTVAGGAGLDTSIDNEDEGDQDATTNMISELVSQGAELNATLDKTGET
SLHLAARYARADAAKRLLDMGADVNFQDHTGRTPLHAAVAADAMGAFQILLRNRSTNLNA
RMHDGTTPLILAARLAIEGMVEDLIHADADINIPDNSGKTALHWAASVNNVDAVNILLAN
NANKDAQDDKDETPLFLAAREGSFEACKALLDNFANREIADHMERLPRDVASERLHHDIV
RLLDSHVAHPNAQTMVPVNNNFMSKSQRNRVSRPLVPLPKNTSSTMTNTTTPATEIDLGM
CLFTDSQHMMSAHSNINIPGMKLSNGGSGGTAKGKKRSKPSNPTSPADSMDSNLSLKRKG
SVKKPPPLPPSSAMSSTAAAPSNKKPFGLDVTCAGGPNNMDLMALDVSRLYGSGVGGIPQ
QPPAYEECLSQLPSASQRPMANYGAAMHHQQHQQQQQQQQQQQQQPDYRVIHQQMMGMQT
SFQEPSPPHSVVMSPSPGKTRPSLPTSPTHMQALRHATMQAVDPFSQFHHFYGSVQQTPQ
SLQPPQSQHAQQYLTPPSDAAPESFPTPSPDSPWHWSSSSPNSNSDWSEGISSPPNNNNN
NNNGHLNKVSDAVYI
Download sequence
Identical sequences J9JXK7
gi|193641183|ref|XP_001948396.1| XP_001948396.1.67334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]