SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193652401|ref|XP_001951879.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193652401|ref|XP_001951879.1|
Domain Number 1 Region: 102-398
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.25e-33
Family NodB-like polysaccharide deacetylase 0.052
Further Details:      
 
Domain Number 2 Region: 29-88
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000201
Family Tachycitin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|193652401|ref|XP_001951879.1|
Sequence length 479
Comment PREDICTED: similar to chitin deacetylase 4 [Acyrthosiphon pisum]
Sequence
MDFALKVIAVIAIYFCPIVLCETAEETFVCPEVGGNGNYADPATCRRFYQCVDNFPYLNR
CPAGLYFDDVNKLCTFKNEARCGPLPSTEAPSTENPIDLAPKCDTSQCTLPYCFCSRDGT
IIPGGLDPKETPQMILLTFDGALNQNNYDHYQKVFSHNKKNPNGCLIKGTFFISHEYCDY
NMVQEIAHKGHEIAVETVSLQKGLHDKGYEEWVAEMIGMREILVNFANLTKSDIVGMRAP
FLKPGRNTQYEVIEDYGFVYDSSIGIPPSRVPIWPYSLDYKIPHECKSGTCPTKSFKGTW
EVPLNAHYVATYEGGHCPYLDQCVLHSHDANEVFEWLREDFERYYSQNRAPYMMPFHTNW
FQIKELEDGLHKFIDWANKQPDVWFVTTTQALTWMTDPKTTKDLSGFEPWMCDKPDQLPS
PPCNLPNKCQLSFKHPETNVVGTRYLSTCKECPRKYPWLGDSKGTGVAGADVYSPDNLK
Download sequence
Identical sequences J9JRK2
gi|193652401|ref|XP_001951879.1| XP_001951879.1.67334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]