SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193669401|ref|XP_001950530.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193669401|ref|XP_001950530.1|
Domain Number 1 Region: 2915-3103
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.29e-33
Family Laminin G-like module 0.00091
Further Details:      
 
Domain Number 2 Region: 2738-2907
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.46e-28
Family Laminin G-like module 0.0058
Further Details:      
 
Domain Number 3 Region: 2308-2494
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.99e-22
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 4 Region: 2499-2699
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.8e-19
Family Laminin G-like module 0.0082
Further Details:      
 
Domain Number 5 Region: 2139-2308
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.92e-18
Family Laminin G-like module 0.0037
Further Details:      
 
Domain Number 6 Region: 675-727
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 7 Region: 1398-1447
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000179
Family Laminin-type module 0.0083
Further Details:      
 
Domain Number 8 Region: 1009-1057
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 9 Region: 617-669
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Laminin-type module 0.0078
Further Details:      
 
Domain Number 10 Region: 149-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000628
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 11 Region: 866-907
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family Laminin-type module 0.0051
Further Details:      
 
Domain Number 12 Region: 914-962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000276
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 13 Region: 818-859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000134
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 14 Region: 337-374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000977
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 15 Region: 770-810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000187
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 16 Region: 1454-1502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000195
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 17 Region: 732-772
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000195
Family Laminin-type module 0.0046
Further Details:      
 
Domain Number 18 Region: 1500-1547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family Laminin-type module 0.0054
Further Details:      
 
Weak hits

Sequence:  gi|193669401|ref|XP_001950530.1|
Domain Number - Region: 202-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000106
Family Laminin-type module 0.03
Further Details:      
 
Domain Number - Region: 272-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000148
Family Laminin-type module 0.034
Further Details:      
 
Domain Number - Region: 1068-1114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00753
Family Laminin-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|193669401|ref|XP_001950530.1|
Sequence length 3106
Comment PREDICTED: similar to laminin alpha-1, 2 chain, partial [Acyrthosiphon pisum]
Sequence
IYQVSYIIMKFGISSRPGNWILERSTDGGIKYKPWQYFAINGEECIQKYDVQPAFNKDKI
VQIYRNATCITSFSRFKPHENAEIHINLLKGHNSMNLTSTEILDFSAAQHIQLRMQKIIL
PNDKMAMLDNSFKRKLFYSIKDIFIGGRCICNGHAKKCKEMSENSEPSCDCLHNTCGPNC
DRCCPMYNQRPWKSGPVICEKCQCHGHATECQYDPIVDEEKSSLDIYGTYSGGGICINCS
KHTMGTNCEVCELGWYRPINVQPDDPEPCLSCECHPDGSDGNVCIPDKETGIALCNCLKG
YGGAKCNECAPGYNGFPNCKPCACDERGIKTVPLSCESQCDCKEHVTGDNCDKCKMGYFN
LKSTNPDGCEKCFCSGVSSICKTATNLKATRINETEGWLITDLKLTKTIFPSTDPSTGLA
LISSFDIPVDVDSFYWLSPSQFTGNKLSAYGSSLYFSISWVIMRGDSSGRQMLDPDVIII
AKENILIAYGGKNLRYSNNISGNVNLTENDWFYVTRDFKNLETPVDNTEVSRDEFLSILS
DIKHILIKAKYHTNQVESNLISAYMDMGDINGSGQVIDGIESCTCPIGYSGLSCENCDYG
YVKQIDPFSTNIICKKCNCHNHSPECDQISSHCSICEHNTTGPQCNECAIGFYGNAIEGT
PNDCKKCACPLDESSNNFSPTCKSNSVGGYICTECPEGYSGDHCEICAPTYFGNPLVIGS
TCKPCDCNEAPCDNLTGQCINCLGNTIGWNCKECKPGHFGNPIISDCRPCDCNAIGSVIT
DSCNVDTGQCQCKENFTGRTCDRCMDGLGNTTAECVECNCNHIGSISDLCDPRSGLCPCK
KGVSGINCDTCSEGFHLFSNQGCTECQCNKTGSNNNICDPITGQCNCRSNVIGNQCDACN
DGFWNISETGCQKCSCDKIGAINDICNSENGQCTCKLGIGGKNCDQCLPNYYGFSILGCS
ECEVCEKPGHTCDMDTGRCVCPQLTEGPNCSLCTANAFRWEINKGCQECHCDSFGAFNGL
CNNETGSCVCRTGYDGPKCDKCSFGYYGYPRCRPCACNYAGSEPNQCNETLCGCDEFGQC
ECKINVYGKRCDQCKDGTFGLHPINSDGCIPCFCFGRSNSCTAAGLTWNQIRLSQTRTLS
INYDTNNNTLYREGDYPVNTQEICYINLANPDSTGLKPNKDERNQLNVTNNLRVIPGTIS
NVEIGVKYLFDTPVYWQLPKRFCGDKVLSYGGYIRFTIDAEGGNTLFPQSILTSYPLIQI
QGNDHIILEHFPSTINVGTSHQVRLHESLWQVKNNPSAKVSREILMLALQNIKYIFIRAT
DSVDFTTATLKDVTLDTATMSQKKTNHLTASQIVEVCDCPPEYNSSSCQDPSLGYFRYYN
TSVSATIIIQTVGEARQCECNGRSSICNVDTGICKNCTHNTGGAHCDVCAEGYYGDPFTD
GCKPCPCPSVTKNYAQSCEIDFDGKLICHCKQGYKGSMCDQCEYGWFGYPREEGGKCEPC
QCNKFGIVSDECHEETGQCNCMPNITGRDCSVCQDKHVLTSKGCTPCEDKCIDTLLDHVF
KQIKLLNETTLHLAEGMISPPWSQLSSVRKNITFLNNIINTSSQENLKLISLSDEVDQNL
KKKFKYAFVKAKKLLKSSQTNENEIQPLHELAENKLTNSIALEREVDELVNSLQSYSFED
RSHVNIISTMREAKNYLSKINNIDFGPSIDPKAILKTCSDAMQNLQLNTGSQAQTINLRH
KFETLLNQVKDFDNILLNLSDTSEITVQLKQQNFESLNDLNKMIEDINHLDLTFSTIQGD
TKELLKEARENYFSSLNKLEELLLIKPKLENIKKNMNKGKDFNPRFDDDQLLVNSAEIHA
NYLLQTAQKYAELFKPIRHDANIALEASNAYLNIVDSLQLARNAAINASILADTSFKTAY
PGVYQESLIDKAKTAEELSKLTYSSTTDIKNIVDSLQSDFDIQVDEIETIKNDMKQIVKN
DNLNSKQITELEQSEGMNMELNNKEDVDPLVIASSNVETKIKNIQDNIDNKLRPVLAQLN
EEGEPSLTIAQDRIDETEEHGKKAIDMLSRILKTSEDFSKKVAAFNHSMNAKLEALRNKI
TKAHQIADGIRISISGQENGTDNACIRTYQPKFLEPSTRTTIVLSYAISSNERDALLFYL
ASKTTGDFVAIEMVNRKIRFVWDVGGGIGEITHPMHIQTASDLNNDQHWYRIEAERIHNL
GKLLIRPQVVPNGSSLAMGSPHTNMSSAGMGRLDINSDDQIWIGGIDKAPLPSYLHSRQH
GLIGCLHQVWLDGRPVGLWNFKSQPSGTCSACIEGAEDLVDDGSYRFFGDGYAVLHYDTT
TTYNKYLFSVSLSFKTFDERSLLFLVEGSQPDQYIEIRIHDGKIVFRVSYSGYSLLEISS
TSRYNTGSWTKLEATRYFDRKKKLEKGVLKVGGESKEGVPSPPPNQNDIPDLSESEYMVG
GVSPGFKSISGLPKSFLGCMSDIQIAQQGYNPMRGISWGVQPTCSDKPLTVVGFYGNGYL
ELVSHTLKKKASFGFMFATLQQDVLLMLSTTESLIPGVTNTSENAEEINNNIDQENKQNY
YSVSLRRGQVDIRINAGRGEVRLASEGFEFGDGKYHSIMVTKNGKKLELRIDDVLHSSSS
LPEGTNIVKAPGTAGGLFLGGLPIEINTTGKAVSSVPLIGTIKDAIFNDQLLFFDSPIEF
EHAAIGQVGPVPQKDNNVYSEIASMTSADKSVGCVKEGSFSLEPGAVKFGDNPNSYVHVT
FSKRHNMQKNFKMDFRFRSFYPNGLIFMLIGTRGKQTNYLLMHLYNGRVQLVLKTRKRVE
ISTQAVFNDGIWHKIQLVRENKTLNFIIDSIPQEKLNLTKKLSTGNTMYVGGIPEKDIQL
PESLNVQPFRGCMQGFAINHQEEELVSEKAIRHKVGQCFPQVEKGSFFPGDAYAIYKNKF
YVGALLELSLELKTTQSTAVLLSVSEPEGYPALSLELNQGKVIISGDMGDRRPFRVEQSF
QSEFAICDNKWHQIQAFYVEDKLTLKVDQFEQKYWLLDNGHITGARTHSPLYIGGLPDAA
SSGTLGTRENFKGCIRNLVIGGERTDWTNMAGLHNILLGSCPLIVH
Download sequence
Identical sequences gi|193669401|ref|XP_001950530.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]