SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193671671|ref|XP_001948450.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193671671|ref|XP_001948450.1|
Domain Number 1 Region: 172-482
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 6.39e-28
Family NodB-like polysaccharide deacetylase 0.024
Further Details:      
 
Domain Number 2 Region: 125-162
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000659
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 42-110
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000628
Family Tachycitin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|193671671|ref|XP_001948450.1|
Sequence length 567
Comment PREDICTED: similar to LDLa domain containing chitin binding protein 1 CG8756-PC [Acyrthosiphon pisum]
Sequence
MTGKAALAVALLMCLSQAIDNCNGFMTPREKRQADEGDEQSVDELCKNRPADEYFRLSTE
GDCRDVVRCDQAGENGITRLAGVRCPQGLAFDIDRQTCDWKTRVKNCDKLDKPRKALPNL
KTDEPVCPKDQLQCGNGECINKDLFCNDRPDCKDESDENACSVETDPNRAPDCDPNQCVL
PDCFCSADGTRIPGGLEPSQVPQLITITFNGAVNVDNMDLYEEIFNNSLPNRMNPNGCSI
KGTFFVSHKYSNYAFIQELHRKGHEIAVFSLTHKDDPKYWTGGSYDDWLAEMAGARLITE
RFANISDGSIVGIRAPYLRVGGNKQFQMMEHQFFVYDASITASLGRVPIWPYTLFFRMPH
KCNGNAQNCPSRSHPVWEMVMNELDRRDDPTFDESLPGCHMVDSCSNIQTGEQFGRLLRH
NFNRHFSTNRAPLGLHFHASWLKSKREFKDELIKFIEEMLKRNDVYFVNMLQVIQWMQTP
TELDNMRDFTEWKDENSKCDVKGQPFCSLSNPCPLTTRELPGETIRLFTCMECPNYYPWI
LDPTGDGFSTRRKRNIHLNFKNKNHYV
Download sequence
Identical sequences X1WI58
XP_001948450.1.67334 gi|193671671|ref|XP_001948450.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]