SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193671741|ref|XP_001949114.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193671741|ref|XP_001949114.1|
Domain Number 1 Region: 48-117
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000106
Family HLH, helix-loop-helix DNA-binding domain 0.0049
Further Details:      
 
Domain Number 2 Region: 114-165
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000314
Family Hairy Orange domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|193671741|ref|XP_001949114.1|
Sequence length 213
Comment PREDICTED: similar to enhancer of split protein, putative [Acyrthosiphon pisum]
Sequence
MRPAAELRPSYRVQMHMQMQQQQQHYQHQHQSGSEYDEQPVSRTYQYRKVMKPLLERKRR
ARINRCLDELKDLMVVTLQAEGENVSKLEKADILELTVRHLHKLKRHNALGLTGVDSVYA
DKFRAGFAHCATEVSNYLTSDVRSPPVDPSAGVKLLHHLGACMRKIDVDSNRPASGPVAT
AATTADQYRPYTPPSTPGSELKEDPNSVCWRPW
Download sequence
Identical sequences J9K9W2
XP_001949114.1.67334 gi|193671741|ref|XP_001949114.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]