SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193672840|ref|XP_001949468.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193672840|ref|XP_001949468.1|
Domain Number 1 Region: 316-416
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 810-961
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.51e-25
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0039
Further Details:      
 
Domain Number 3 Region: 1279-1427
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.08e-23
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0052
Further Details:      
 
Domain Number 4 Region: 7-153
Classification Level Classification E-value
Superfamily C-type lectin-like 1.29e-22
Family C-type lectin domain 0.00096
Further Details:      
 
Domain Number 5 Region: 189-301
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-22
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 6 Region: 2545-2750
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-20
Family Laminin G-like module 0.031
Further Details:      
 
Domain Number 7 Region: 418-533
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-19
Family Spermadhesin, CUB domain 0.00084
Further Details:      
 
Domain Number 8 Region: 1031-1096
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000389
Family Complement control module/SCR domain 0.00092
Further Details:      
 
Domain Number 9 Region: 654-725
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000751
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 10 Region: 2186-2316
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000691
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 11 Region: 2351-2389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000025
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 12 Region: 2041-2078
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000131
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 13 Region: 146-186
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000034
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 14 Region: 592-657
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000361
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 15 Region: 3100-3244
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000471
Family Growth factor receptor domain 0.0076
Further Details:      
 
Domain Number 16 Region: 2156-2199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000108
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 17 Region: 716-777
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000737
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 18 Region: 964-999
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000948
Family EGF-type module 0.021
Further Details:      
 
Domain Number 19 Region: 2386-2426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000251
Family EGF-type module 0.017
Further Details:      
 
Domain Number 20 Region: 2452-2540,2761-2775
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000487
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 21 Region: 531-603
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000132
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 22 Region: 2312-2355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000141
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 23 Region: 1869-2019
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000157
Family Growth factor receptor domain 0.0038
Further Details:      
 
Domain Number 24 Region: 1168-1236
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000709
Family Complement control module/SCR domain 0.0052
Further Details:      
 
Domain Number 25 Region: 2120-2164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000738
Family EGF-type module 0.007
Further Details:      
 
Domain Number 26 Region: 2080-2123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000155
Family EGF-type module 0.013
Further Details:      
 
Domain Number 27 Region: 768-806
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000082
Family EGF-type module 0.037
Further Details:      
 
Domain Number 28 Region: 2429-2463
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000949
Family EGF-type module 0.015
Further Details:      
 
Domain Number 29 Region: 3171-3202,3238-3381
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000294
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 30 Region: 3372-3410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000578
Family EGF-type module 0.016
Further Details:      
 
Domain Number 31 Region: 1232-1278
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000737
Family Complement control module/SCR domain 0.0044
Further Details:      
 
Weak hits

Sequence:  gi|193672840|ref|XP_001949468.1|
Domain Number - Region: 1821-1882
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00513
Family Growth factor receptor domain 0.0047
Further Details:      
 
Domain Number - Region: 1623-1679
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00702
Family Complement control module/SCR domain 0.0043
Further Details:      
 
Domain Number - Region: 2860-2915
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0167
Family Complement control module/SCR domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|193672840|ref|XP_001949468.1|
Sequence length 3555
Comment PREDICTED: similar to SP1070 CG9138-PA [Acyrthosiphon pisum]
Sequence
MTWNIQTPGTGLFSCPSGWELKGLHCYKFFSIKHSWENAAQLCNRYGSDLVLIESYTENN
YTASLARRSLGPVDRNNQKYWLGLASLDDLRTNTLEYAGGVLVSQYSGFWSLSQPDPSSG
ECVDVTVTDEQQSWELQTCESLLPFLCRANACPTGSFHCSNGRCINSAFKCDKQNDCGDW
SDELDCSSNCHYYMANSGDVVESPNYPHKYEALSNCKWTLEGPQGHNILLQFQEFETEKS
FDTVQILVGGRTEDKAVNLATLSGKMDLSNKMFVSASNFMIVKFSSDASVERKGFRASWK
TEPQVCGGNLRATTQPQPLTSPGFPNNYPGGLECLYTITAQAGRIITLEIEDLELQQNRD
FVLIRDGDSPKSQPIGRLTGSLENNPRLLMSTGNQMYLYFKTSLGDSKKGFKIKYSQGCK
ATITAANGTIASPTFGLSNYPSNLECLIKIKNPTMSPLSLKFDSFVLHQSDYVQVYDGAS
TSGLRLHPNNGFTGSTPPKITLTAASGEMLVRFVTDALHNQKGWHATFSADCPTLKPGEG
ALESNRDTAFGTTVTFSCPVGQEFATGKSKITTECLISGNWSVSYIPKCQEVYCGPVPQI
DNGFSTGSTNVTYRGQAMYQCYAGFAFPSNEPIEKVSCLADGRWERLPTCLASQCPPLPE
TPHANFTVLNGGGRSYGTIVRFQCESGYVRSGHPVVLCMSNGTWSSGVPVCSRAECLVLP
EIHNGFVIDQTRKYLFGDEARVQCHRGFKLTGGSSIIKCGANQTFSNVPKCEDVNECAAS
QCDLSSTECVNNLGGFHCRCKTGFAPTMECRPVGDLGLISGGISDDSITVSGSEPSFTKE
MMRLNTMRGWCGTNVEPGDNWVLIDLKAPTVIRGFRSQGVMRGSNKIAFSSAIRIQYSNN
LTDVFRDYTNPDGTPVEFRILEPSLSVLNFPMPIEAQYIKLKIQDYVVAPCLKLELIGCT
RLDCVDINECSVNNGGCQQKCINSPGSYACSCNIGYELYVKNGTAGFVINEFESGERDGD
VYQRNKTCVPVMCPNLQAPENGVVLSTKESYHFGDLVNFQCKFGYVMAGSASLLCTSTGA
WNGTVPQCQFAKCVSLPDDKIEGLKVSRFEKDAVLVPFKENVTLKCENPGRTLRGTATSG
FRQCVYDPKPGFPEYWLSGATPSCPRVDCGVPMPTAGAEYGNFKDTRYQSSFFFGCQDTF
KLAGQTDKNDNVVRCQANGVWDFGDLRCEGPVCQDPGRPTDGYQVATSYEQGSEVQFGCN
KPGYILINPRPITCIREPECKVIKPLGLTSGRIPDSAINATSERPNYEARNIRLNSVTGW
CGKQEAFTYVSVDLGQVYRVKAILVKGVVTNDIVGRPTEIRFFYKQEEKENFVVYFPNFN
LTMRDPGNFGELAMITLPKFVQARFVILGIVSYMDNACLKFELMGCEEPKVEPLLGFDYG
HSPCVDNEPPVFQNCPTQPIIVRRGPNGIEPVNMTEPVPVDNSGSIARLEVKPQSFKLPF
YTFQDTAVKYVAFDFDGNVAICEINITVTDETPPQLSCPQSYVIELVNKQDNYVVNFNET
RRRINVSDASGEVTLTFNPDRASIAIGDFENVTVTAADKFGNKATCYFQVSVQATPCVDW
DLKPPSNGALNCLPSDDSGLECIATCKAGFRFTDGQPTKSFTCEQRSLWSPSSVVPDCVS
EDTHQADYHVVPSVTYRANGAVPSLCLRQYADILSQHYGPLNDILTERCSAVKVNMNVSF
IDTKPQLLDENLVQIDFVLGVLPEVRQPQLYDFCGSTLNLVFDLSVSYASAAIEPLLNIS
AVANQCPPLKALRSSVSKGFTCNIGEVLNMDTNQVPRCLHCPAGTFAGIKQTSCMPCARG
YYQDTARQGACMKCPNGTYTKELGSKSLKDCIPVCGYGTYSPTGLVPCLECSRNSYTSEP
PTSGFKECVSCPPNMFTYQPSAPNKDFCRAKCPPGQYSETGLAPCSPCPPNHYQAGSGQT
VCLGCPTNTKTKGPGAAGRDECQSIVCTESSCLHGGLCVPLGHGIQCFCPAGFSGKRCEI
DIDECASQPCFNGGSCIDLPQGYRCQCKNGFSGINCQEEKSDCKNDTCPERAMCKDEPGL
GNFTCLCRSGYTGQNCDMTIDPCMETINPCKNSATCTALKQGRYKCECKPGWEGEHCDIN
IDDCAERPCLLGAACTDLINDFKCACPPGFTGKRCETKIEICAANPCQNGVCVDRLFSHQ
CVCHPGWTGAACEINIDDCASNPCGNDGECTDMVNGYSCTCDVGYTGKRCQHLIDDCASG
PCQNGGSCVDMLDGFMCRCRPGYLGLQCEAGIDECLSDPCSPEGTEQCLDLDNNYKCVCH
PGYTGYMCEKNIDDCASSPCMNNGKCYDGVNTFSCQCPPGWTGKRCEIDLSSCQSKPCYN
DATCINLFQDYFCVCPSGTDGKQCETAPERCIGNPCMHGGRCQDFGSGLNCTCPSDYDGI
GCQYEFDACQANTCKNGATCIDNGPGYKCICPPGFMGKNCDEDIVDCKENSCPPTATCID
LTNKFYCQCPFNLTGDDCRKTIQVDYDFSFPEETLSSAALTVPFQFTGARDSFTIAMWVQ
YAQKDEPGIFFTLYSVTSPHVVQGQRVLIQAHSSGVEVSIFPELQDVFLAFHEYTTINDG
QWHHIAIVWNQGTLTLITEGLIASKMEGYGTGRKLPEFGWAVLGKPRMDRKTFTEAGFKG
QLNKVQVWGRALDVTNEVQKQVRDCRTEPVLYQGLVLTWAGFDDIQGGVERIVPSKCSQH
SCPVGYTGPNCEQLQVDKKPPQVEYCPGDLWVIAKNGSAVVNWDEPRFTDNVGVVRVEEK
NGHKPGQTLLWGTYRIAYVAFDEVGNAAVCSFRVYVLSEFCPTLADPIGGKQQCKDWGSG
GQFKVCEISCNPGLRFSQEVPKFYTCGAEGFWRPTIDPAYPTIYPACSASKPAQRVFKVD
MKFPTSVLCNEAGQGVLRQKVRNAINTLNRDWNLCSYSIKGTRECKDLNIXXTRECKDLN
IDVKCDHRSSRPTRNVTVYDEYDSAIVIREKRQASDTYSVQISFPAINDPVVNSNSNQRA
NIQRLLEKLILEEDQFDVHDILPNTVPDPASLNLESDYACPIGEVVMAPDCVPCSVGSYF
EKETKKCVPCAVGSYQSESGQLQCSVCPAIAGRQGVTVSTGARSASHCKERCPAGKYYDD
EAGLCRSCGYGFYQPSEGSFKCLLCGLGKTTRTTEAVSREECRDECADGMHLGMEGECEP
CPRGTYRTQGVEPACQQCPAGRTTKQSGASSIEECSLPVCVPGTYLNATQNSCISCKKGT
YQPATQQTNCLPCPPNMSTKTIAATSKSECWNPCEANVAGKHCDVNADCLLIPETSDFKC
ECRPGFNGTGKVCKDVCDGYCENKGTCVKDLRGQPSCRCVGSFIGPHCEDKSDFAYIAGG
IAATVVFLIVIALFVWMICARSERVKEPKKLMAQTNDQTGSQVNFYYGAAPYAESIAPSH
HSTYAHYYDDEEDGWEMPNFYNETYMKEGLHNGKMNSLARSNASIYGNKEDLYDRLKRHA
YNGKKDKSDTESECQ
Download sequence
Identical sequences gi|193672840|ref|XP_001949468.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]