SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193683408|ref|XP_001944333.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193683408|ref|XP_001944333.1|
Domain Number 1 Region: 750-801
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000837
Family Laminin-type module 0.0092
Further Details:      
 
Domain Number 2 Region: 303-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000363
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 3 Region: 853-901
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000586
Family Laminin-type module 0.00048
Further Details:      
 
Domain Number 4 Region: 962-1003
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000614
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 5 Region: 466-521
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000114
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 6 Region: 908-959
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000162
Family Laminin-type module 0.0027
Further Details:      
 
Domain Number 7 Region: 419-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000106
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 8 Region: 805-855
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000151
Family Laminin-type module 0.0072
Further Details:      
 
Domain Number 9 Region: 363-421
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Laminin-type module 0.022
Further Details:      
 
Weak hits

Sequence:  gi|193683408|ref|XP_001944333.1|
Domain Number - Region: 1010-1056
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000204
Family Laminin-type module 0.012
Further Details:      
 
Domain Number - Region: 712-752
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00502
Family EGF-type module 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|193683408|ref|XP_001944333.1|
Sequence length 1648
Comment PREDICTED: similar to Laminin B2 CG3322-PA [Acyrthosiphon pisum]
Sequence
MKLIPMSPLSLLLTAVVAAAVVAAVPDVTIPVEPIYNTGGNQCYDERNKPXXXXXXXXXX
XXXXXXXQRCIPGFENAAFGLEVEATNTCGQSGPTEFCVQSGSQVTKKTCDVCTESSHSP
YYMTDFSSYANRTWWQSETMYESVQYPNQVNLTLHFGKAFDITYIRLLFYSPRPESFAMY
KKSTEDGPWIPYQFYSGSCRDTYGLPDLNYIRLGEQETRAFCTSEFSDISPLTGGSVPFS
TLEGRPSAKFYDTKSEFWDWVTATDVRITLDRLNTFGDEVFGDPQVLKSYFYAIADFAVG
ARCKCNGHASECVKSTSINGTSRRVCRCEHNTAGPDCNECLPFFNDAPWSRATATNAHEC
KECNCNEFSHRCFFDKELYDRTGHGGHCLDCAGNRDGANCERCRENYYQRKGDTHCSPCE
CNDVGSRSLQCNSEGKCQCRAGVAGDKCDRCAENHFDFGPTGCKPCGCIVAGSLDNEPRC
EAENGNCICKENVEGIQCNKCKPGFFNLDEDNLFGCTPCFCYGHSSVCQSASGYSRVSIE
SVFVRGNERWNGSDVFGRTVLPVHSPFKQSLEISSPSKDAVYLLAPDKFLGDQRSSYNHD
LTFKLSIGENSPDPTINDIILEGGAGLRVTQAIFGQGNTLPSDTPKMYKFRLHENPDYGW
QPRLSARDFFSVLSNLTAIKIRGTYSDRGVGFLDDVSLQTARRGAPGLPANWVEMCTCPE
GYIGQFCESCAPGSRHEPTSGGPFSPCVPCNCHGHASICDADTGRCICQHNTAGENCDRC
AKGYYGNAMQGTALDCKLCPCPNQGSCVLIGEDTVICLECPKGYGGPRCDICSDGYFGDP
TGKTGPISICKSCDCNSNVDPNGIGNCNRTTGDCLKCIYNTGGPQCDQCLPGYFGDALAP
EKGDCKPCDCFHLGTTETGFGPLACDQLTGQCQCKPHVTGVNCDQCEVGHFNIASGEGCQ
SCDCDPVGSVNNTCDTNTGQCICRPGITGKKCDACEPYHYGFSIEGCKSCACDTIGAVSL
QCDANGQCPCLENVEGRRCDQCKENKYDRQRGCVDCPACYNLVQDAVAAHRENLRKLEDV
LKNINNNPTVVIDDDFEQKLKEVQSQVDELEQNAKFATGGNIPTSDKLESLQSQIKEIQD
LMAQTGSWTATAEEKSIEAENNIMNIEKINDKAANTLKRALEYIETEGATSLLKAVTKSN
ELGQQSDQMSEIAREARTFLASKEEEMEKMRVTAEKARHVSLEAYNITRDAVNQQKNISD
ELKSLDTEVNYVKDKLNTIITSANEAQELVTMVNNDSLTIYRDIYAINLPDVNVAALKEN
ISNLNAESEQIKNDLKIQETDLNISKLIKDVADELQQSEITLAQGEQQQRTRENYLAQAN
ASYEKADQAVKLGVKILEEAQQTLSTLQAFDKQVQDSKKNATEALGQVSQIRQLIEEAND
KTIRAQQALAGAELSAIHARDTAKEAQQTYADQASEDSNKIKKAGENLASEVHKLFDESM
GQIKRVGHTAERLKDAEIQFEQDQKSIDDAKTKIGQAKTSASESKKMVDKALQDVENISK
ELLDLADSDTDKLSLLSSRLESAEQELMNAELDKKLAAINSAKISQAQLINKLKEDIKTL
TNDVKNIEAIRLALPVGCWKKTNIEELR
Download sequence
Identical sequences gi|193683408|ref|XP_001944333.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]