SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193685865|ref|XP_001952253.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193685865|ref|XP_001952253.1|
Domain Number 1 Region: 307-337
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000735
Family Ovomucoid domain III-like 0.0065
Further Details:      
 
Domain Number 2 Region: 269-299
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000568
Family Ovomucoid domain III-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|193685865|ref|XP_001952253.1|
Sequence length 387
Comment PREDICTED: similar to AGAP010646-PA, partial [Acyrthosiphon pisum]
Sequence
EEPCDLGCDGLNYCTVFNNRPTELFRSCSPQTDDAAHYDVTLWRQRGTITLFNYELPLKN
ITKCLPDSWKAVACILQIRPCTRQSHVNKICRDDCLELLSTCLDWSNSAPGLSANALCAR
LSPNSGPCVPLGAFAELGAPRPPPPRLQTELQHVAVEDLPEVTTPCKRNPCAPGSVCLVN
RGCRIGRGCKPYRCVAGCKAGEVSHFLVPEDSYARIPTFNGQKGCAKICLCTKRGIEKCQ
QVPCSQIQSCWLVGKPIVSEKASCEDAPKGVVCDTDGGEHSNLCHLLRSGKTLAYSGPCL
VGCNSTGRVCGVDGNTYPSECAAFAESTSVDYSGPCASSGFIGHNGRPYCAAKGAVDCPK
LPQQGCQGITPPGACCPKCAGALQILF
Download sequence
Identical sequences gi|193685865|ref|XP_001952253.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]