SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193702355|ref|XP_001948320.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193702355|ref|XP_001948320.1|
Domain Number 1 Region: 150-282
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 6.67e-18
Family Toll/Interleukin receptor TIR domain 0.0021
Further Details:      
 
Domain Number 2 Region: 20-104
Classification Level Classification E-value
Superfamily DEATH domain 0.00000337
Family DEATH domain, DD 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|193702355|ref|XP_001948320.1|
Sequence length 358
Comment PREDICTED: similar to myd88, partial [Acyrthosiphon pisum]
Sequence
MDPASCSTVSEDFANILISVLRLPTRERLSCMLNATKVIPSPEKLPRDWRGLCTLLNYTI
PSGCDPTDPIGKIFKFCEAKTTIAHFTRCLERIDRYDVVEETEELFISDIKYFKEQCSLA
KYPTPVVPNDFDINIITLDDINSSSNGLPLTRYDAFLLYDKADIQSAAAVVEKLETDYKL
KLCLKDRDLRPGVMFEYQSIIKLISDRCNWLIIIVSNDFSNSPWNRFIVNYIQSLAIEKR
LPKIIPCVFDDCVLPEELKCYVHLYFNKYNPFCDPWQKLMITVSPYKNLALADSVKANPS
CQNTSITTVDKKKVIKFSSEEINLPPKPPKPKSVFDRLVKTVGNISVKVVPTKWNKKK
Download sequence
Identical sequences gi|193702355|ref|XP_001948320.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]