SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193709368|ref|XP_001949708.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193709368|ref|XP_001949708.1|
Domain Number 1 Region: 1372-1420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000112
Family Laminin-type module 0.006
Further Details:      
 
Domain Number 2 Region: 1463-1513
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000446
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 3 Region: 543-591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000024
Family Laminin-type module 0.047
Further Details:      
 
Domain Number 4 Region: 1908-1962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family Laminin-type module 0.0051
Further Details:      
 
Domain Number 5 Region: 277-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000279
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 6 Region: 1800-1852
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 7 Region: 497-545
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 8 Region: 1858-1910
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family Laminin-type module 0.065
Further Details:      
 
Domain Number 9 Region: 634-681
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000112
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 10 Region: 734-784
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000181
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 11 Region: 589-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000265
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 12 Region: 451-499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000271
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 13 Region: 1511-1559
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000446
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 14 Region: 787-826
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000865
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 15 Region: 679-731
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000977
Family Laminin-type module 0.0064
Further Details:      
 
Domain Number 16 Region: 336-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000265
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 17 Region: 1765-1802
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Laminin-type module 0.075
Further Details:      
 
Domain Number 18 Region: 1418-1460
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000558
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 19 Region: 406-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000586
Family Laminin-type module 0.041
Further Details:      
 
Weak hits

Sequence:  gi|193709368|ref|XP_001949708.1|
Domain Number - Region: 1961-2002
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000229
Family Laminin-type module 0.032
Further Details:      
 
Domain Number - Region: 89-141
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00243
Family APC10-like 0.026
Further Details:      
 
Domain Number - Region: 1080-1140
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase II 0.00593
Family Peptidyl-tRNA hydrolase II 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|193709368|ref|XP_001949708.1|
Sequence length 2003
Comment PREDICTED: similar to laminin A chain, putative, partial [Acyrthosiphon pisum]
Sequence
MHAIAVGVLWALVALQLARPVWPEVLTPPYFNLAEGRRITATATCGQGLQGPELYCKLVG
ANSERNVDYEGNLVIQGQVCDHCDDSRPDKSHPPEYAVDGQETWWQSPPLSRGMKYNEIN
LTIDLGQEFHVAYVVVKMGNSPRPGVWVLERSADHGQTYLPWQYFADTVADCESYFGKES
IKPISSDDSVICDTSVSKIVPLENGEIFVKLLSNRPSANNFFNSYALQEFTRATNVRFRL
LRVKNLLGHLMSVARQDPTTTRRYFYSIKDVSIGGRCRCNGHADLCDITDPTDSYKLICR
CQHNTCGHNCERCCPGFEQKAWSQSKYDKLFECEPCNCFGHSESCVYDNATDTSHLSIDI
HGKYEGGGVCQNCRDHTTGINCDKCVFGFYRPVGKLLNETDVCQPCNCDHFYSTGNCSEG
FGKCECKAAYAAPDCDRCSEGYYGYPDCKPCECFLDGTRGRQCENTGGQCPCKQNFGGKF
CYQCADGFYNFPQCKSCECNEIGSRNSICDQKTGQCLCHSSYGNLSCDQCNHGYYGFPTC
SYCNCDLIGSLPEVCNKTNGQCMCKEGYAGPRCDKCLHSYNGYPDCKPCGCSERGSATSI
CDASGKCPCLPSFAGRTCEQCSPGYYQYPECKFCDCDSQGSIGVSCDNDGKCKCKPNFMG
TRCDKCKEGLYNFPICEECNCNPAGVLSTFVGCGSLPLGELCQCKPRVNGRICDECRELF
WNLQPTNPDGCQECDCFMPGVLSGVGVCNPKSGQCVCKPSATSRRCDECSEGFYSLNENS
LFGCTECGCNVGGSINEKCDKNNGQCLCQPRIVGRACTEPMQAHYFPTLHQLLYEAEDGR
TPAYTPVRYGFDDKFFPDYSWKGYAVFSQLQSEIVQELNIEKPSIYRIVLRYVNLNNETI
LGLISITPETPNNINIEQKFMVQLKPTKTPTFVTVSGATGNIPSPFVMNPGRWAVTIKIE
QNLFVDYFVILPAEYYEGDILVDKVLNPCVIDNIEVGLCRHFDYPSTSKFDQVKSTTALT
LEGKEPIDFVDNLKQLDILGVPKLPVISEAQPELDLELSIVNPGPYVILINYMTPSSIQT
KAVIEIEVDEKMNSGKAILYACHHTTLCRQAAVDATGKVALFDINKPVTKVILKGGKDHS
KVGIESIVALPLDKWSLDYINPNPSCVKKDGKCIQSFYPTPPDTKKVEFKTGNEARLSTT
APKDIFDNTTALIILDHKDSIVDLAGKVPAPGAYVFIVQFYQPDFPAFEMNALIHNGQTY
EAVLPIKHCPSNSGCRSVVKQANGNINFQLTENFLLSLKEPNHKSVWLEYVLVVPAQEYS
DSITVEQPFDYTGLFIANCGSNHFYINTSTTGFCKEATFSLTTAYNSGALPCNCNSDGSL
SYVCDPYGGQCQCKPNVIGRRCEACKTGYFGFPDCKSCNCPSVATCETSSGECICPPRVV
GKNCDQCEPMTYGFDPIIGCEECNCNFFGVEDKNRQCDLFNGSCECKENIVGRSCDHCRS
GHWSFPRCYLCNCDYRGTTSEICNQNNSECFCKSNVYGQACDLCKEGTFNIQEKNDEGCS
KCFCFGKTTRCQSSNLYRTEINDMENWLLKIVNVTTKPIIIEDVEFMVEKIEDNEIGVDL
TPRKLQEKITYFFAPKKYLGNQIKSYGGFLNYSIQYTSNLFGSAVGGPDVILYGHDTYLF
YFSLEQPASSTLFPNFVEIVEQNFILANGLQTTREQIMQVLQNLDGIYIRATYWEPTVTT
RISSISLETAQEEYIQSKEIALSVEQCQCPANYVGLSCEECADGFYRAQTGPYGGFCVPC
QCNGHSNTCDKATGICNNCKHSTTGDHCEKCIIGYHGNASIGTPYDCLICACPLPIASNN
FATGCEVSPDGNKISCDCIPGYFGARCESCNAGFYGSPETPGEVCKECQCSGNINKEDPG
ACDSITGKCTRCLNSTFGESCQYCRPGYFGDAVNLKDCQACDCDKCGMEKCDNYNGLCVC
HQNVEGEKCDRCAVNHYGFETCK
Download sequence
Identical sequences gi|193709368|ref|XP_001949708.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]