SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|193712529|ref|XP_001943895.1| from Acyrthosiphon pisum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193712529|ref|XP_001943895.1|
Domain Number 1 Region: 457-491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000287
Family EGF-type module 0.011
Further Details:      
 
Domain Number 2 Region: 417-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000594
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 494-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family EGF-type module 0.009
Further Details:      
 
Domain Number 4 Region: 280-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000331
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 5 Region: 538-572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000035
Family EGF-type module 0.011
Further Details:      
 
Domain Number 6 Region: 369-420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000594
Family EGF-type module 0.021
Further Details:      
 
Domain Number 7 Region: 330-366
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000955
Family EGF-type module 0.029
Further Details:      
 
Weak hits

Sequence:  gi|193712529|ref|XP_001943895.1|
Domain Number - Region: 170-317
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000518
Family Growth factor receptor domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|193712529|ref|XP_001943895.1|
Sequence length 750
Comment PREDICTED: similar to Delta [Acyrthosiphon pisum]
Sequence
MVSFTGKRMKMHPYPVDCNGVFELRIKSFSNELGREASGSCCGGVCGTPCRTKFRACLKH
YETNINVNSTCTFGDVVTPVLGENSLTLPANATPIAFHFNFTWPGTFSLIVEAWHEPSSA
RNSGTTNGSALITRITDQRFLKLSDGWVQQEYAGSTGGVRSRLVYEHRVRCEDNYHGDGC
AKFCRPRDDNFGHYLCSDDGDMICMPGWTGSYCSKAICAPGCDEKKGTCMTPGTCQCHAG
WTGARCDQCQIYPGCVNGYCQKPWQCLCKEGWGGMFCNQDLNYCTNHAPCKNGGTCFNTG
QGLYTCACAPGYTGPECNVDMGLTNKPGMDCSTGLTCLNGGTCKKTGSVSSCTCPSQWKG
IRCETSTQPACASSPCGNGGTCVNAAKTNGTGTGGNNNGYVCHCPIGFSGPTCHQTTNHC
QPDPCRNGATCVPSKDSSSYTCKCAPGFAGAHCHLPDHCQKNPCLNGGTCQAQADGFRCQ
CVPGYVGDLCLSVVDYCVAKPCANGGTCENLKNDFRCGCRPGFGGKDCSRYVNECVLSSP
CANGGTCVTTGGSDGGFRCECPVGYTGANCTDERPTSLGDRSKHVSAVVQEQPEMVQASV
NGVLMVVLSVSVPVAVLAAIAVVLCMKNRRRRDQKKADDNARMQNEQNSIHSVAKLGDPH
VIRNSWDPLPAAARENVYSEPLCFAAPNKMQQPSLTPAQSSSSLQRQKLLNTDRQNRMSF
KEQDAINALDRRISVISVDSAANQCNNTNK
Download sequence
Identical sequences gi|193712529|ref|XP_001943895.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]