SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71736148|ref|YP_277269.1| from Pseudomonas syringae pv. phaseolicola 1448A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71736148|ref|YP_277269.1|
Domain Number 1 Region: 26-333
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 7.38e-109
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000212
Further Details:      
 
Domain Number 2 Region: 333-490
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-29
Family Glycosyl hydrolases family 32 C-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71736148|ref|YP_277269.1|
Sequence length 497
Comment sucrose-6-phosphate hydrolase [Pseudomonas syringae pv. phaseolicola 1448A]
Sequence
MNGPMSNTLERAHHALKDSLAQVIHDYRPGYHLAPPAGWMNDPNGVVYFRGEYHVFYQHH
PFDAKWGPMYWGHAKSADLVHWQHLPIALAPGDDFDQDGCFSGSAVVCGDTLALIYTGHT
WLGEVGDELLIRQVQCLATSLDGINFVKHGAVIDSPPQDTIIHFRDPKVWQQDDHWYLIA
GARLGDRPLLPLYRSVDLHAWEFVSYVSSGNEGDGYMWECPDLFRLDGRDVLLYSPQGMP
AQGYERLNKFHTGYRVGQIDSQRQFNGGPFIELDNGHDFYAAQTLVAADGRRLVWAWLDM
WESPTPTATHLWRGMLGLPRELELRDDRLCVHPARELTALRNASLPGTPWWSEAGTQWLT
DVHGDLLEIHVHLDLLDCTEGHLGVALRCSSDGKEQTLLYYDASLKRLILDRDQSGTHVS
GQRSVAIDPQQERLELRVFLDRSSIEVFDQNGSFSFSSRLYPQTDSLGVKLIANGTGGRV
CIANAWELSSGCLQVNH
Download sequence
Identical sequences Q48BH6
WP_011169931.1.10739 WP_011169931.1.12791 WP_011169931.1.27185 WP_011169931.1.28195 WP_011169931.1.70455 WP_011169931.1.86037 gi|71736148|ref|YP_277269.1| 264730.PSPPH_5192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]