SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pench1|66548|e_gw1.1.2910.1 from Penicillium chrysogenum v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pench1|66548|e_gw1.1.2910.1
Domain Number 1 Region: 792-987
Classification Level Classification E-value
Superfamily Sec7 domain 1.57e-71
Family Sec7 domain 0.0000051
Further Details:      
 
Domain Number 2 Region: 1250-1668,1864-1950
Classification Level Classification E-value
Superfamily ARM repeat 5.35e-16
Family MIF4G domain-like 0.064
Further Details:      
 
Weak hits

Sequence:  jgi|Pench1|66548|e_gw1.1.2910.1
Domain Number - Region: 235-323,458-627
Classification Level Classification E-value
Superfamily ARM repeat 0.000627
Family Diap1 N-terninal region-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pench1|66548|e_gw1.1.2910.1
Sequence length 1984
Sequence
MRTYICIRWIHNVHALSYVCLQNQTMSILPGKRGAVRTLESPTPAGTRGSIILAEITPPG
VSLTMADTELGSEPTQSIEMPKKPVETPDVSPTVPNSDEPALPEQTEPQEPVHKGDEEVA
KGQDDEEKPEVPPKDEPEQTEQEPQTDGPPTIQEPPQDDNDATESRLRSDSRSTTATFMT
QRSSPVSSTVFIVTALDNIAASRDARRDKKLEDATQVALANIRQPDGQAIDPELIFRPLH
LASKALSIPLQVTALDCIGKLITYSYFAFPSAETENNATREQPPLIERAIDAICDCFENE
ATAVEIQQQIIKSLLAAVLNDKIVVHGAGLLKAVRQIYNIFIYSKSSQNQQIAQGSLTQM
VSTVFDRVRTRMDLKELRVRELEKPSSTLDASASDVGQTSETASMPVADQPVTKEPTTEK
LTLQSFESPKEVTGVNDNAPTTVTRAKRSATRSMSGIPEEKDDDSSAEDDVDEIYVKDAF
LVFRALCKLSHKVLTHEQQQDVKSQNMRSKLLSLHLIHYLINNHTATFISPLAAIKNSSS
SADGMNLLLAVRPHLCLSLSRNGSSAVPHIFKVCCEIFWLMLKDMRVMMKKELEVFLKEI
YLAILEKRGAPAFQKQYFMEILERLGGDPRALVEIYLNYDCDRTALENIFQNIIEQLSRY
SSVPVVTTPSQQHQYQEQHTKMSAIGSEWHHRGTLPPSLTSAHIVPTPPPSMPHIPSEYG
LKQQALECLVEILRSLDNWATHRIDEQPEAAMPSKSMDNSRESLDTSVLVSPHPETLEGG
TGRSTPMPEDDPNQIEKVKQRKIALTNAIQQFNFKPKRGIKALLKEGFIQSESPEDIASF
MLRTDRIDKAVLGEYLGEGDPENIAIMHAFVDLMEFTKRRFVESLRSFLQHFRLPGEAQK
IDRFMLKFAERYTTQNPNAFANADTAYVLAYSVILLNTDQHSSKMKGRRMTKEDFIKNNR
GINDNQDLPTDYLGAIYEDIGSNEIVLYTEQEHAANLNPQPAAPTGLATRAGQVFATVGR
DIQGEKYAQASEEMANKTEQLYRSLIRAQRKTAVKDALSHFIPATSERHVGSMFNVTWMS
FLSGLSAPMQDTSNLETIRLCMEGLKLSIRISCAFDLETPRVAFVTALAKFTNLGNVREM
MAKNVEALKALLDVAFTEGNHLQGSWRDVLTCVSQLDRLQLLSDGVDEGSLPDVSRAPSS
ADTSRRSMQSTRRARPRSVNGPTAFRPEIAMESRSADMIRGVDRIFTNTANLSHEAIIDF
VRALSEVSWQEIQSSGHTDSPRTYSLQKLVEISYYNMTRVRIEWSKIWDVLGQHFNQVGC
HSNTMVVFFALDSLRQLSMRFMEIEELPGFKFQKDFLKPFEHVMANSTTAAVKDMILRCL
IQMIQARGDNIRSGWKTMFGVFTVAAREPYEGIVNMAFDHVTQVYNTRFGVVITQGAFAD
LIVCLTEFSKNSKFQKKSLQAIETLRSTVTKMLRTPECPLSHRGASAATFQDNGTNLAKQ
LTRQSQEEQFWYPILIAFQDVLMTGDDLEVRSRALTYLFDTLIRHGGDFPRDFWDVLWRQ
LLYPIFVVLQSKSEMSKVPNHEDLSVWLSTTMIQALRNMITLFTHYFDALEYMLSRFLEL
LTLCICQENDTIARIGSNCLQQLILQNVAKFKQEHWSQIVGAFVELFSKTTAYELFTAAV
SMSKPAEAVNGDLTQSPDAAVATSDLPDALQPNGSQSTSSIHDGGDPPVQSEARAELEDY
RPQSDQQQPAAVTAARRRYFNRIITNCVLQLLMIETVHELFSNENVYAQIPSGELLRLMG
LLKKSYQFAKKFNEDKDLRMQLWRQGFMKQPPNLLKQESGSASTYVHILFRMYHDEREER
QSSRAETEAALIPLCADIIRSFVRLEEDTQHRNIVAWRPVVVDVIDGYTNFPQDDFNNHI
ETFYPLGVELLSRDLNPEIRVALQSLLRRIGEVRLGIAPPNPLDVPISPRSSVSQKAPRR
DSQV
Download sequence
Identical sequences jgi|Pench1|66548|e_gw1.1.2910.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]