SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pench1|67386|e_gw1.1.516.1 from Penicillium chrysogenum v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pench1|67386|e_gw1.1.516.1
Domain Number 1 Region: 606-801
Classification Level Classification E-value
Superfamily Sec7 domain 3.66e-63
Family Sec7 domain 0.0000156
Further Details:      
 
Domain Number 2 Region: 329-456,509-540,939-975,1004-1075,1109-1460
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000000819
Family HEAT repeat 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pench1|67386|e_gw1.1.516.1
Sequence length 1584
Sequence
MDSSSLSIAIDPVALVTTECITVTSSMRKHARWAHSSVSAILGGNGASRVYERDNSAPSS
PGPRRSGTPRPDEDHVLANRWGLRGKKGKSMQDNPLISAFTRLRSDLKDCKDIRTFDTPA
LLHPFLQVVRSSSTSAAITSIALVSITKFLSYNIINPNSPRLPLAMQLLSAAITHCRFEA
SDSSADEIVLLRILKLMEGILSRPEGELLGDESVCEMMETGLSMCCQGRLSEVLRRSAEM
AMVKMCQVIFMRLSHLDQEMPAGSDPFAGEDTKKDPPSRLKMDPSVNGDTVTSQHLSAIS
ADTAAAERHSTSREGSPEQAGNGSATAAAAPPSLHDDSETELQPYSLPSIKELFRVLIDL
LDPHNRQHTDAMRVMALRIIDVALEVAGPSIARHPSLAALAKDDLCRYLFQLVRSEHIAI
LTGSLRVAGTLLSTCRPVLKLQQELYISYLVACLHPRVEIPREPGINPLLYEGIPQSPKL
VKQPASQANSGRSTPVPVKDRQKLGLEGGARRPEAREAMVESIGMLSRIPSFMVELFVNY
DCDVDRADLCEDMIGLLSRNAFPDSATWSTTNVPPLCLDALLGYVQFIHDRLDDEPVQGD
YPAQETLKKQRYTKKLIIKGAQMFNEDPKKGIAFLVSHGVIEDANNPVLVARFLKGTTRL
SKKVLGEYISKRGNEELLGAFVDLLDFSGRNAVEALRELLSSFRLPGESPLIERIVTTFS
EHYIEKVKPAGIADKDALYILTYAIIMLNTELYNRNVKSQNRMTCAGFARNLRGVNGGGD
FAEDFLEDIYESIKNNEIILPDEHENKHAFAYAWKELLLKSSSAGDTIVGETNMYDAEMF
AATWKPVIATLSYVFMSASDDAVYSRVVNGFDQCAQIAARYGLTEAFDRIVFSLASISTL
ATSKPPSTALNTEVQVGQKSVMVSELAVKFGRDFRAQLATVVLFRVLSTNEATVKQGWEH
IVRILSNLFINSLIPPFDAKLTSELDISPIPLQPPSQVVDRDGRNNDTGILSAFTSYLSS
YAADDPPEPSDEELDNTLCTVDCVTACSISEILTNIKSLPLSSLEMLVEALLSLLPEENA
PAVIVVKPERPTPTSRAANGRADPNQPKYDPSMVFVLELATVLTLRDEKTLEALGENLAT
TLQTLVRDAKNLHPLTVSRVVSYLLNLLRLSHDQHFMRVPVVLHAISGFDQDILETVAVA
TVKGLARCIAHTGRLRNEITISPDFWSILQRLHQHEAVASLVFELLQSIVESMPDIITAD
NYEFVVSLANDFVSAGRVGSIEERHRDAQARRNKGVKQSKSSENQVVTRGVKAIGLIYHL
TGRVPALIKQSHLEENEAWAAYWSPIFQSLTSQCINPCRDIRHHAISTLQRSLLSAELIS
SDDEEWTSIFDEVLFPLVLLLLKPEVYHSDPVGMSETRFQAATLVCKIFLRFLDQLPNRT
GMLPLWLRILDILDRMMNSGQGDSLAEAVPESLKNILLVMADGGYLVPPSQDPSKEEIWV
ETRTRLGRFLPDLFSEIFPDTANEPEKPAPGSTIPSPEQPHETEKASEAEAKSEDPSPRQ
DSEEPKEGANAESQTTQKEEESTS
Download sequence
Identical sequences jgi|Pench1|67386|e_gw1.1.516.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]